Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VVP5

Protein Details
Accession A0A0C9VVP5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-36MVAMRNCKCKQPKKWHNPVIIVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 6, plas 4, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCHHPSLVDVVPRLMVAMRNCKCKQPKKWHNPVIIVLYWSFTTTGTVCVTLLNDSLKIVGVVLVVLAGFLGACLHLVQYFETRENTPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.16
4 0.25
5 0.28
6 0.37
7 0.38
8 0.46
9 0.55
10 0.61
11 0.68
12 0.69
13 0.76
14 0.78
15 0.88
16 0.88
17 0.85
18 0.79
19 0.71
20 0.64
21 0.53
22 0.43
23 0.32
24 0.25
25 0.18
26 0.14
27 0.11
28 0.07
29 0.07
30 0.06
31 0.08
32 0.07
33 0.08
34 0.07
35 0.07
36 0.08
37 0.07
38 0.08
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.05
46 0.04
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.04
62 0.05
63 0.06
64 0.08
65 0.12
66 0.15
67 0.17
68 0.2