Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9V1J7

Protein Details
Accession A0A0C9V1J7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-56NDTWSENRSKRRRKSWTSRRRCRMDDLHydrophilic
NLS Segment(s)
PositionSequence
38-45SKRRRKSW
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MILVSLSTNETQRTQRLRMFSILLRYPPFNDTWSENRSKRRRKSWTSRRRCRMDDLCIGSIYGVQLLSMQSKKLKTRLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.4
4 0.41
5 0.4
6 0.4
7 0.36
8 0.36
9 0.34
10 0.32
11 0.3
12 0.28
13 0.27
14 0.25
15 0.23
16 0.18
17 0.18
18 0.19
19 0.22
20 0.25
21 0.31
22 0.33
23 0.41
24 0.5
25 0.58
26 0.61
27 0.66
28 0.72
29 0.75
30 0.82
31 0.84
32 0.86
33 0.87
34 0.9
35 0.9
36 0.88
37 0.81
38 0.79
39 0.75
40 0.7
41 0.67
42 0.63
43 0.55
44 0.47
45 0.44
46 0.34
47 0.28
48 0.21
49 0.13
50 0.07
51 0.05
52 0.06
53 0.07
54 0.12
55 0.12
56 0.15
57 0.19
58 0.25
59 0.31