Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VFW7

Protein Details
Accession A0A0C9VFW7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
158-187DSPVGKYLKIVRKARERRRKLLEKAREGEDBasic
NLS Segment(s)
PositionSequence
166-181KIVRKARERRRKLLEK
Subcellular Location(s) mito 18.5, cyto_mito 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005343  Noc2  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF03715  Noc2  
Amino Acid Sequences RHTNTYIPLGPQLLPILSYTLAPSTSSKSASLRALPFDTTIRAPAPYLRTRIYAECLAEEAVFVLAEWMGTPNVQGSIAFPEISVPIVLGMRKALKVAREGGGKGGAGKQVAEVKNLVERIEEGVKWVEEKRRNVSFGPAQLDEVKRWEEKLSAKVGDSPVGKYLKIVRKARERRRKLLEKAREGEDEILEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.12
5 0.11
6 0.11
7 0.1
8 0.11
9 0.12
10 0.13
11 0.16
12 0.18
13 0.19
14 0.2
15 0.21
16 0.24
17 0.27
18 0.31
19 0.28
20 0.29
21 0.29
22 0.28
23 0.28
24 0.26
25 0.24
26 0.2
27 0.2
28 0.17
29 0.15
30 0.15
31 0.18
32 0.23
33 0.25
34 0.28
35 0.27
36 0.29
37 0.31
38 0.32
39 0.33
40 0.29
41 0.25
42 0.22
43 0.21
44 0.19
45 0.16
46 0.14
47 0.1
48 0.07
49 0.06
50 0.05
51 0.04
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.08
65 0.09
66 0.09
67 0.08
68 0.08
69 0.08
70 0.09
71 0.08
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.06
78 0.06
79 0.06
80 0.07
81 0.08
82 0.09
83 0.11
84 0.13
85 0.15
86 0.16
87 0.16
88 0.16
89 0.15
90 0.14
91 0.13
92 0.12
93 0.1
94 0.09
95 0.08
96 0.09
97 0.14
98 0.15
99 0.15
100 0.14
101 0.14
102 0.17
103 0.17
104 0.16
105 0.1
106 0.1
107 0.12
108 0.13
109 0.12
110 0.11
111 0.12
112 0.12
113 0.14
114 0.16
115 0.21
116 0.25
117 0.3
118 0.35
119 0.38
120 0.41
121 0.4
122 0.44
123 0.41
124 0.39
125 0.39
126 0.33
127 0.3
128 0.32
129 0.33
130 0.27
131 0.26
132 0.24
133 0.2
134 0.21
135 0.2
136 0.2
137 0.23
138 0.27
139 0.29
140 0.28
141 0.28
142 0.31
143 0.31
144 0.32
145 0.29
146 0.26
147 0.26
148 0.26
149 0.25
150 0.23
151 0.31
152 0.34
153 0.43
154 0.48
155 0.5
156 0.6
157 0.71
158 0.8
159 0.82
160 0.82
161 0.83
162 0.87
163 0.89
164 0.88
165 0.89
166 0.88
167 0.87
168 0.83
169 0.79
170 0.7
171 0.63
172 0.56