Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UBG3

Protein Details
Accession A0A0C9UBG3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-75ASSCHRWSSKGRKHNDKDDEFHydrophilic
NLS Segment(s)
PositionSequence
75-82FKKGKKDK
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MVYAAFIPVLSCILVWAASHSGVSATPNPNARGGAQEPLRIADQLPLYKFNATVASSCHRWSSKGRKHNDKDDEFKKGKKDKGGEVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.08
6 0.08
7 0.08
8 0.08
9 0.08
10 0.1
11 0.13
12 0.14
13 0.17
14 0.2
15 0.21
16 0.22
17 0.22
18 0.21
19 0.2
20 0.19
21 0.22
22 0.19
23 0.2
24 0.19
25 0.19
26 0.2
27 0.16
28 0.14
29 0.12
30 0.12
31 0.13
32 0.13
33 0.14
34 0.14
35 0.14
36 0.14
37 0.12
38 0.13
39 0.12
40 0.11
41 0.12
42 0.15
43 0.16
44 0.17
45 0.2
46 0.19
47 0.21
48 0.29
49 0.37
50 0.43
51 0.51
52 0.59
53 0.67
54 0.73
55 0.81
56 0.83
57 0.79
58 0.79
59 0.76
60 0.76
61 0.69
62 0.67
63 0.66
64 0.65
65 0.63
66 0.63
67 0.63