Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9U0I2

Protein Details
Accession A0A0C9U0I2   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
22-59SSASAAPSKKSKRKRKRKRKRKRKRKNHPVPENNNPGPBasic
64-87GSTSGPPPTKKRKAKGPARTLQSWHydrophilic
NLS Segment(s)
PositionSequence
28-50PSKKSKRKRKRKRKRKRKRKNHP
69-80PPPTKKRKAKGP
Subcellular Location(s) nucl 23, cyto_nucl 15.5
Family & Domain DBs
Amino Acid Sequences MSQRSNPSTSIPESHGPEANASSASAAPSKKSKRKRKRKRKRKRKRKNHPVPENNNPGPEPDAGSTSGPPPTKKRKAKGPARTLQSWTEPICV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.32
4 0.3
5 0.28
6 0.24
7 0.19
8 0.15
9 0.13
10 0.1
11 0.1
12 0.12
13 0.11
14 0.13
15 0.2
16 0.29
17 0.37
18 0.47
19 0.57
20 0.66
21 0.77
22 0.86
23 0.9
24 0.93
25 0.96
26 0.97
27 0.97
28 0.97
29 0.97
30 0.97
31 0.97
32 0.97
33 0.97
34 0.97
35 0.97
36 0.96
37 0.95
38 0.91
39 0.89
40 0.86
41 0.76
42 0.66
43 0.55
44 0.45
45 0.36
46 0.29
47 0.22
48 0.13
49 0.14
50 0.14
51 0.14
52 0.14
53 0.13
54 0.18
55 0.18
56 0.2
57 0.27
58 0.36
59 0.46
60 0.54
61 0.6
62 0.66
63 0.74
64 0.82
65 0.85
66 0.85
67 0.83
68 0.82
69 0.79
70 0.72
71 0.67
72 0.61
73 0.56