Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9UQZ4

Protein Details
Accession A0A0C9UQZ4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-107VMLSMTNRRRNYKRKGKKRVAKHydrophilic
NLS Segment(s)
PositionSequence
93-107RRRNYKRKGKKRVAK
Subcellular Location(s) nucl 13, mito 10.5, cyto_nucl 9.333, cyto_mito 7.666
Family & Domain DBs
Amino Acid Sequences MNTVNASTGFSPFQLKTGRSPRLIPPLTPIPDDASADSITAHHIISRLQTDVQEAQDNLLAAKVRQAYHANEHRSPEERYEIGDLVMLSMTNRRRNYKRKGKKRVAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.3
4 0.39
5 0.44
6 0.42
7 0.46
8 0.47
9 0.53
10 0.53
11 0.45
12 0.42
13 0.44
14 0.44
15 0.41
16 0.36
17 0.29
18 0.28
19 0.29
20 0.23
21 0.17
22 0.14
23 0.13
24 0.13
25 0.09
26 0.09
27 0.09
28 0.08
29 0.06
30 0.06
31 0.07
32 0.08
33 0.09
34 0.09
35 0.09
36 0.09
37 0.11
38 0.12
39 0.13
40 0.12
41 0.11
42 0.11
43 0.11
44 0.11
45 0.09
46 0.08
47 0.07
48 0.06
49 0.09
50 0.11
51 0.11
52 0.14
53 0.17
54 0.18
55 0.27
56 0.34
57 0.37
58 0.37
59 0.39
60 0.39
61 0.4
62 0.39
63 0.34
64 0.31
65 0.26
66 0.25
67 0.25
68 0.23
69 0.19
70 0.19
71 0.16
72 0.11
73 0.11
74 0.09
75 0.07
76 0.12
77 0.17
78 0.24
79 0.29
80 0.37
81 0.46
82 0.56
83 0.67
84 0.73
85 0.79
86 0.82
87 0.89