Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9V007

Protein Details
Accession A0A0C9V007    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKRPPLVSRRAPKRRKTSPSVPTAPHydrophilic
NLS Segment(s)
PositionSequence
8-16SRRAPKRRK
Subcellular Location(s) mito 18, cyto_nucl 5, nucl 4.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKRPPLVSRRAPKRRKTSPSVPTAPVVDFKFQPASTVKPGRKHKGVHDVKPELRQNIVMAGPYGQQSVQSPNLPFQRPGLAALVKPKGFRTRGGSPPLKPSTPPPPITGDDNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.86
4 0.85
5 0.83
6 0.83
7 0.79
8 0.71
9 0.63
10 0.56
11 0.48
12 0.42
13 0.35
14 0.28
15 0.22
16 0.22
17 0.24
18 0.21
19 0.23
20 0.2
21 0.22
22 0.27
23 0.35
24 0.37
25 0.42
26 0.5
27 0.55
28 0.59
29 0.58
30 0.57
31 0.59
32 0.63
33 0.61
34 0.61
35 0.61
36 0.57
37 0.61
38 0.57
39 0.47
40 0.4
41 0.34
42 0.25
43 0.2
44 0.18
45 0.11
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.06
52 0.06
53 0.07
54 0.11
55 0.13
56 0.15
57 0.15
58 0.2
59 0.26
60 0.27
61 0.26
62 0.24
63 0.26
64 0.23
65 0.25
66 0.23
67 0.19
68 0.18
69 0.24
70 0.28
71 0.25
72 0.25
73 0.27
74 0.31
75 0.32
76 0.35
77 0.37
78 0.4
79 0.46
80 0.54
81 0.57
82 0.52
83 0.6
84 0.61
85 0.55
86 0.48
87 0.47
88 0.49
89 0.51
90 0.51
91 0.44
92 0.44
93 0.46