Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9W0J8

Protein Details
Accession A0A0C9W0J8   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
59-92HPTPSPPPLRPKRPRQKTSKTYNACRKQKSRCELHydrophilic
NLS Segment(s)
PositionSequence
66-75PLRPKRPRQK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
Amino Acid Sequences MSSVKVQASSESDAGKENRRASGLRWDERPQATTNLPLVWTARRRKLQSVRTPILPPLHPTPSPPPLRPKRPRQKTSKTYNACRKQKSRCELLPGDLNGCHRCEGIGIACVFQTETTPTETAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.33
4 0.31
5 0.32
6 0.34
7 0.34
8 0.32
9 0.4
10 0.42
11 0.4
12 0.43
13 0.44
14 0.49
15 0.5
16 0.49
17 0.41
18 0.37
19 0.33
20 0.31
21 0.29
22 0.22
23 0.21
24 0.19
25 0.18
26 0.19
27 0.25
28 0.28
29 0.35
30 0.41
31 0.43
32 0.52
33 0.6
34 0.64
35 0.66
36 0.69
37 0.65
38 0.61
39 0.6
40 0.53
41 0.48
42 0.38
43 0.32
44 0.26
45 0.27
46 0.23
47 0.25
48 0.27
49 0.31
50 0.34
51 0.33
52 0.39
53 0.44
54 0.54
55 0.6
56 0.67
57 0.7
58 0.77
59 0.84
60 0.84
61 0.86
62 0.85
63 0.86
64 0.86
65 0.82
66 0.81
67 0.83
68 0.84
69 0.81
70 0.8
71 0.79
72 0.78
73 0.8
74 0.77
75 0.75
76 0.68
77 0.68
78 0.62
79 0.58
80 0.55
81 0.46
82 0.42
83 0.35
84 0.34
85 0.28
86 0.27
87 0.23
88 0.17
89 0.16
90 0.14
91 0.15
92 0.13
93 0.16
94 0.15
95 0.15
96 0.15
97 0.15
98 0.15
99 0.12
100 0.12
101 0.1
102 0.11
103 0.14
104 0.15