Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VC43

Protein Details
Accession A0A0C9VC43    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-87VDSCRRCKKSHPRELCKDLAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 11, cyto 11, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002867  IBR_dom  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01485  IBR  
Amino Acid Sequences MDKPKAYGGPSPTDDVSLVHFEKLKEREEIKIALSTEVLEDCPFCDFAMIIPFTFMELPDFYCMGCGVDSCRRCKKSHPRELCKDLADALRSTEEAKTQALVRYCPGCNTPFIQIDGTNFWKCSCGTKSCYSCRKKVSSKVFHYSIFKPLWTRFPKRCSNKYANEAEMEIKHNKEVQEAEKKARAKLLPKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.26
3 0.25
4 0.23
5 0.21
6 0.19
7 0.21
8 0.2
9 0.28
10 0.31
11 0.3
12 0.31
13 0.32
14 0.34
15 0.35
16 0.37
17 0.31
18 0.32
19 0.3
20 0.24
21 0.23
22 0.18
23 0.15
24 0.14
25 0.13
26 0.08
27 0.08
28 0.07
29 0.09
30 0.09
31 0.07
32 0.07
33 0.06
34 0.07
35 0.13
36 0.13
37 0.11
38 0.11
39 0.11
40 0.12
41 0.12
42 0.11
43 0.07
44 0.07
45 0.09
46 0.1
47 0.1
48 0.09
49 0.09
50 0.09
51 0.08
52 0.07
53 0.06
54 0.08
55 0.15
56 0.19
57 0.24
58 0.33
59 0.35
60 0.37
61 0.47
62 0.55
63 0.59
64 0.67
65 0.72
66 0.73
67 0.78
68 0.83
69 0.76
70 0.66
71 0.55
72 0.47
73 0.37
74 0.29
75 0.21
76 0.16
77 0.12
78 0.11
79 0.12
80 0.1
81 0.09
82 0.08
83 0.08
84 0.08
85 0.09
86 0.12
87 0.12
88 0.12
89 0.13
90 0.15
91 0.15
92 0.16
93 0.16
94 0.15
95 0.15
96 0.17
97 0.19
98 0.17
99 0.18
100 0.17
101 0.16
102 0.16
103 0.18
104 0.21
105 0.18
106 0.17
107 0.16
108 0.16
109 0.16
110 0.2
111 0.21
112 0.22
113 0.26
114 0.34
115 0.41
116 0.48
117 0.57
118 0.57
119 0.6
120 0.62
121 0.66
122 0.65
123 0.69
124 0.71
125 0.71
126 0.73
127 0.74
128 0.7
129 0.65
130 0.63
131 0.55
132 0.51
133 0.42
134 0.36
135 0.32
136 0.31
137 0.38
138 0.4
139 0.46
140 0.47
141 0.54
142 0.63
143 0.69
144 0.74
145 0.74
146 0.75
147 0.76
148 0.77
149 0.76
150 0.68
151 0.6
152 0.53
153 0.48
154 0.41
155 0.36
156 0.31
157 0.26
158 0.26
159 0.27
160 0.26
161 0.26
162 0.29
163 0.32
164 0.39
165 0.42
166 0.47
167 0.5
168 0.52
169 0.51
170 0.53
171 0.51