Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UHM5

Protein Details
Accession A0A0C9UHM5    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
224-248PITVADKVRRSPRKQQDAPKIPSSRHydrophilic
NLS Segment(s)
PositionSequence
236-237RK
243-243K
248-249RS
251-251K
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MAPNDRWPITPPTPKAHSPIHITGFIDCIDSKSGLPVITIEDLTLEIGNRRVTELANMARIQAVMLRHPHQQHITEAGEIAPIEVDAEWRYPNSMVSLSSVTPHSTAYPIPFPLLPPSCAPGEPRPIDTGYHYPEFPYPAPLDAFDEINAHAMVDPNNIAETGCASRPEDISSESNISLEFPYPSSQAKGLRSVSARSDDEDEGAGSSKKSIINDDIVYLEDIPITVADKVRRSPRKQQDAPKIPSSRSSKRIKQIHAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.56
4 0.52
5 0.51
6 0.53
7 0.49
8 0.46
9 0.44
10 0.39
11 0.35
12 0.29
13 0.24
14 0.17
15 0.14
16 0.14
17 0.14
18 0.14
19 0.14
20 0.16
21 0.14
22 0.14
23 0.13
24 0.13
25 0.14
26 0.14
27 0.11
28 0.1
29 0.1
30 0.1
31 0.1
32 0.08
33 0.07
34 0.1
35 0.12
36 0.11
37 0.12
38 0.13
39 0.13
40 0.15
41 0.19
42 0.19
43 0.21
44 0.21
45 0.2
46 0.2
47 0.19
48 0.17
49 0.14
50 0.12
51 0.12
52 0.16
53 0.18
54 0.23
55 0.25
56 0.29
57 0.3
58 0.31
59 0.29
60 0.3
61 0.29
62 0.24
63 0.23
64 0.18
65 0.16
66 0.13
67 0.11
68 0.06
69 0.04
70 0.05
71 0.04
72 0.05
73 0.05
74 0.06
75 0.06
76 0.07
77 0.08
78 0.08
79 0.08
80 0.09
81 0.09
82 0.09
83 0.1
84 0.12
85 0.11
86 0.12
87 0.12
88 0.11
89 0.11
90 0.11
91 0.09
92 0.09
93 0.09
94 0.1
95 0.12
96 0.11
97 0.12
98 0.12
99 0.12
100 0.16
101 0.17
102 0.16
103 0.15
104 0.17
105 0.16
106 0.17
107 0.19
108 0.17
109 0.22
110 0.22
111 0.22
112 0.22
113 0.22
114 0.22
115 0.22
116 0.23
117 0.19
118 0.19
119 0.18
120 0.17
121 0.17
122 0.19
123 0.17
124 0.16
125 0.13
126 0.12
127 0.13
128 0.12
129 0.14
130 0.12
131 0.12
132 0.09
133 0.1
134 0.09
135 0.09
136 0.09
137 0.07
138 0.06
139 0.07
140 0.07
141 0.07
142 0.07
143 0.06
144 0.06
145 0.06
146 0.06
147 0.05
148 0.06
149 0.07
150 0.08
151 0.09
152 0.1
153 0.11
154 0.12
155 0.13
156 0.13
157 0.14
158 0.15
159 0.16
160 0.18
161 0.16
162 0.16
163 0.14
164 0.14
165 0.11
166 0.1
167 0.09
168 0.08
169 0.1
170 0.11
171 0.12
172 0.13
173 0.16
174 0.19
175 0.21
176 0.26
177 0.26
178 0.29
179 0.29
180 0.3
181 0.3
182 0.31
183 0.3
184 0.26
185 0.29
186 0.25
187 0.24
188 0.22
189 0.19
190 0.14
191 0.15
192 0.13
193 0.09
194 0.09
195 0.11
196 0.13
197 0.13
198 0.16
199 0.18
200 0.22
201 0.22
202 0.23
203 0.21
204 0.2
205 0.2
206 0.17
207 0.14
208 0.09
209 0.08
210 0.07
211 0.07
212 0.07
213 0.08
214 0.11
215 0.15
216 0.19
217 0.25
218 0.35
219 0.45
220 0.5
221 0.6
222 0.67
223 0.75
224 0.8
225 0.85
226 0.86
227 0.87
228 0.87
229 0.85
230 0.79
231 0.69
232 0.69
233 0.68
234 0.65
235 0.63
236 0.66
237 0.66
238 0.71
239 0.79