Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9U232

Protein Details
Accession A0A0C9U232   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-94VPDGEDREPKKRKKEQKGEQKKKPQIKHGESBasic
149-170SSPPPPKPEPPKQPKHTQQANKHydrophilic
NLS Segment(s)
PositionSequence
5-14RGKLSARRGE
56-57RK
69-90DREPKKRKKEQKGEQKKKPQIK
122-163RKARKTAAKEKAERIAKAQKPKAAPEPSSPPPPKPEPPKQPK
Subcellular Location(s) mito 12.5, nucl 12, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR026680  CCDC137  
Amino Acid Sequences MPHKRGKLSARRGERAKIGSDLAPPGAISVASEAIPKNVMRVLQAEEIRKVHNEKRKRQLEEGVPDGEDREPKKRKKEQKGEQKKKPQIKHGESLGAFNRRVEEEMRVELSEAFQTSRTETRKARKTAAKEKAERIAKAQKPKAAPEPSSPPPPKPEPPKQPKHTQQANKMVEFGKATVGKRFNDIVQAPPTFTKLPRGAKKIEAQGGGKSKKADVVSMAQKQMMDIEREKAIKHYRELKESRLAAGKAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.66
3 0.59
4 0.52
5 0.45
6 0.39
7 0.37
8 0.33
9 0.26
10 0.22
11 0.19
12 0.16
13 0.13
14 0.11
15 0.08
16 0.07
17 0.08
18 0.08
19 0.1
20 0.09
21 0.1
22 0.13
23 0.12
24 0.12
25 0.13
26 0.13
27 0.13
28 0.15
29 0.19
30 0.23
31 0.27
32 0.28
33 0.3
34 0.31
35 0.31
36 0.32
37 0.33
38 0.35
39 0.4
40 0.47
41 0.53
42 0.62
43 0.7
44 0.72
45 0.72
46 0.73
47 0.72
48 0.69
49 0.63
50 0.54
51 0.45
52 0.39
53 0.35
54 0.28
55 0.24
56 0.2
57 0.26
58 0.33
59 0.39
60 0.49
61 0.58
62 0.67
63 0.74
64 0.83
65 0.84
66 0.87
67 0.92
68 0.92
69 0.93
70 0.93
71 0.91
72 0.89
73 0.84
74 0.82
75 0.81
76 0.76
77 0.72
78 0.64
79 0.62
80 0.52
81 0.5
82 0.45
83 0.38
84 0.33
85 0.27
86 0.25
87 0.19
88 0.2
89 0.18
90 0.16
91 0.14
92 0.16
93 0.16
94 0.15
95 0.15
96 0.13
97 0.13
98 0.1
99 0.08
100 0.07
101 0.07
102 0.08
103 0.09
104 0.15
105 0.16
106 0.2
107 0.24
108 0.33
109 0.4
110 0.43
111 0.48
112 0.48
113 0.54
114 0.6
115 0.65
116 0.64
117 0.59
118 0.6
119 0.61
120 0.59
121 0.51
122 0.46
123 0.46
124 0.42
125 0.47
126 0.48
127 0.44
128 0.43
129 0.46
130 0.49
131 0.45
132 0.43
133 0.38
134 0.42
135 0.41
136 0.48
137 0.47
138 0.4
139 0.41
140 0.44
141 0.47
142 0.48
143 0.55
144 0.56
145 0.65
146 0.73
147 0.74
148 0.79
149 0.8
150 0.82
151 0.82
152 0.79
153 0.78
154 0.78
155 0.76
156 0.66
157 0.6
158 0.51
159 0.42
160 0.35
161 0.26
162 0.21
163 0.2
164 0.21
165 0.24
166 0.28
167 0.27
168 0.29
169 0.3
170 0.25
171 0.28
172 0.28
173 0.26
174 0.28
175 0.28
176 0.26
177 0.25
178 0.28
179 0.23
180 0.23
181 0.26
182 0.28
183 0.37
184 0.44
185 0.49
186 0.49
187 0.53
188 0.59
189 0.58
190 0.57
191 0.51
192 0.45
193 0.46
194 0.52
195 0.48
196 0.44
197 0.38
198 0.33
199 0.34
200 0.33
201 0.28
202 0.22
203 0.28
204 0.34
205 0.38
206 0.39
207 0.35
208 0.34
209 0.32
210 0.34
211 0.29
212 0.25
213 0.22
214 0.24
215 0.27
216 0.29
217 0.29
218 0.32
219 0.38
220 0.38
221 0.44
222 0.51
223 0.52
224 0.61
225 0.65
226 0.63
227 0.63
228 0.6
229 0.57
230 0.55