Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9U8I7

Protein Details
Accession A0A0C9U8I7   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
10-38CEKPGPYGPREQKQKKKDQPKSSAQPGRQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 7.5, cyto_nucl 7.5, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MSAEPTCEPCEKPGPYGPREQKQKKKDQPKSSAQPGRQKQCVNLTLYGWMSVFQFMDAHPLKQAVMPAPDPFEGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.52
4 0.55
5 0.56
6 0.66
7 0.71
8 0.74
9 0.76
10 0.84
11 0.84
12 0.87
13 0.88
14 0.87
15 0.86
16 0.86
17 0.84
18 0.83
19 0.8
20 0.75
21 0.74
22 0.71
23 0.68
24 0.64
25 0.56
26 0.49
27 0.49
28 0.47
29 0.4
30 0.34
31 0.29
32 0.26
33 0.26
34 0.23
35 0.16
36 0.13
37 0.1
38 0.1
39 0.09
40 0.07
41 0.07
42 0.06
43 0.15
44 0.15
45 0.15
46 0.16
47 0.16
48 0.16
49 0.17
50 0.2
51 0.15
52 0.18
53 0.2
54 0.21
55 0.23