Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UY83

Protein Details
Accession A0A0C9UY83   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-36STEPKCKPHIWKPPVSCKPRAKKEENIDEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 12.833, cyto 11.5, mito_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MPPDCTSTEPKCKPHIWKPPVSCKPRAKKEENIDEDKGKEDEEALWVGNVIKMCCVLEHACLKCAQSDSSLELMQQLCMFRSHLRVTAMQTVKQMMLDCFVNGAGQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.69
4 0.72
5 0.75
6 0.79
7 0.82
8 0.8
9 0.79
10 0.78
11 0.8
12 0.81
13 0.82
14 0.77
15 0.76
16 0.8
17 0.81
18 0.78
19 0.73
20 0.66
21 0.59
22 0.54
23 0.47
24 0.37
25 0.26
26 0.19
27 0.14
28 0.11
29 0.1
30 0.1
31 0.07
32 0.07
33 0.07
34 0.07
35 0.08
36 0.08
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.08
43 0.07
44 0.09
45 0.15
46 0.15
47 0.16
48 0.17
49 0.17
50 0.17
51 0.18
52 0.15
53 0.12
54 0.13
55 0.14
56 0.16
57 0.16
58 0.14
59 0.15
60 0.15
61 0.14
62 0.13
63 0.11
64 0.1
65 0.11
66 0.13
67 0.11
68 0.16
69 0.18
70 0.2
71 0.22
72 0.24
73 0.27
74 0.35
75 0.36
76 0.33
77 0.33
78 0.31
79 0.29
80 0.28
81 0.26
82 0.17
83 0.17
84 0.16
85 0.14
86 0.13
87 0.13