Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9U063

Protein Details
Accession A0A0C9U063   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
89-109MLSTEHRRRNYKCSGKKRVAKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MKTINVSTGFSPFQLKTGRSPRLIPPLVPRTDTATLTPAEMDAQIIIDKLRTDVSEAQDRLLAAKIRQAYHANQHRGPEDVYAVGDLVMLSTEHRRRNYKCSGKKRVAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.3
4 0.39
5 0.44
6 0.42
7 0.46
8 0.47
9 0.53
10 0.53
11 0.46
12 0.46
13 0.48
14 0.48
15 0.46
16 0.4
17 0.36
18 0.37
19 0.36
20 0.28
21 0.22
22 0.2
23 0.19
24 0.18
25 0.12
26 0.09
27 0.08
28 0.07
29 0.05
30 0.05
31 0.04
32 0.05
33 0.04
34 0.04
35 0.05
36 0.05
37 0.06
38 0.05
39 0.08
40 0.11
41 0.14
42 0.2
43 0.2
44 0.2
45 0.2
46 0.2
47 0.18
48 0.18
49 0.16
50 0.09
51 0.13
52 0.16
53 0.15
54 0.19
55 0.21
56 0.2
57 0.29
58 0.38
59 0.4
60 0.39
61 0.41
62 0.39
63 0.38
64 0.37
65 0.28
66 0.2
67 0.15
68 0.13
69 0.11
70 0.1
71 0.08
72 0.07
73 0.06
74 0.05
75 0.04
76 0.04
77 0.05
78 0.13
79 0.19
80 0.25
81 0.31
82 0.39
83 0.43
84 0.52
85 0.62
86 0.65
87 0.71
88 0.76
89 0.81