Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9V6S2

Protein Details
Accession A0A0C9V6S2   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSSKEKRQLRNKISARNFRVRRKGEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 12.499, cyto_nucl 9.833, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
Amino Acid Sequences MSSKEKRQLRNKISARNFRVRRKGESCFITLHLSYPGTPCFRLCWCILAPHSLCPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.79
4 0.8
5 0.78
6 0.8
7 0.74
8 0.72
9 0.67
10 0.65
11 0.61
12 0.56
13 0.48
14 0.4
15 0.37
16 0.32
17 0.26
18 0.22
19 0.17
20 0.15
21 0.13
22 0.13
23 0.15
24 0.14
25 0.15
26 0.15
27 0.16
28 0.18
29 0.21
30 0.2
31 0.21
32 0.2
33 0.26
34 0.27
35 0.32
36 0.31