Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TBP9

Protein Details
Accession A0A0C9TBP9   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
166-192LRSPSRSRSASPKRRRTQQVDDTVKKPHydrophilic
NLS Segment(s)
PositionSequence
165-181ALRSPSRSRSASPKRRR
190-195KKPKKT
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences TTAKGKRRAPTPIIVQSDEDSEDDLDPLPESLQGGPKRSPRTYKSNSKSKAQMQAKAAAPSDSDSDSDSDIVSVSDIVGYVKKKNAASNSASKTKRTPVKDSSRRTEPLKGPDSSPNRTAKTSKQTSSPTKPNGSVTRTYSIHASALEAPSSSSKRGRAFDRDGALRSPSRSRSASPKRRRTQQVDDTVKKPKKTEKAREESVVSPIVTGGRSRRSAAVAATQKLHNEIMPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.55
3 0.47
4 0.44
5 0.37
6 0.28
7 0.2
8 0.16
9 0.15
10 0.13
11 0.13
12 0.11
13 0.1
14 0.1
15 0.08
16 0.08
17 0.09
18 0.1
19 0.17
20 0.2
21 0.23
22 0.28
23 0.35
24 0.42
25 0.46
26 0.53
27 0.51
28 0.58
29 0.63
30 0.69
31 0.71
32 0.74
33 0.73
34 0.71
35 0.73
36 0.69
37 0.71
38 0.66
39 0.63
40 0.56
41 0.6
42 0.56
43 0.51
44 0.45
45 0.35
46 0.3
47 0.24
48 0.23
49 0.16
50 0.14
51 0.12
52 0.12
53 0.12
54 0.12
55 0.1
56 0.08
57 0.07
58 0.07
59 0.06
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.07
66 0.08
67 0.1
68 0.12
69 0.16
70 0.18
71 0.22
72 0.25
73 0.28
74 0.31
75 0.37
76 0.4
77 0.45
78 0.45
79 0.42
80 0.41
81 0.44
82 0.47
83 0.43
84 0.45
85 0.45
86 0.55
87 0.63
88 0.67
89 0.66
90 0.65
91 0.64
92 0.6
93 0.58
94 0.52
95 0.5
96 0.48
97 0.43
98 0.39
99 0.43
100 0.45
101 0.4
102 0.41
103 0.38
104 0.35
105 0.36
106 0.36
107 0.34
108 0.38
109 0.41
110 0.37
111 0.38
112 0.43
113 0.49
114 0.54
115 0.55
116 0.51
117 0.49
118 0.49
119 0.48
120 0.47
121 0.43
122 0.39
123 0.35
124 0.36
125 0.33
126 0.32
127 0.28
128 0.24
129 0.21
130 0.17
131 0.15
132 0.12
133 0.12
134 0.11
135 0.1
136 0.1
137 0.12
138 0.14
139 0.14
140 0.15
141 0.19
142 0.23
143 0.27
144 0.32
145 0.36
146 0.41
147 0.44
148 0.46
149 0.45
150 0.42
151 0.4
152 0.38
153 0.33
154 0.29
155 0.29
156 0.27
157 0.3
158 0.3
159 0.31
160 0.39
161 0.49
162 0.57
163 0.63
164 0.7
165 0.73
166 0.81
167 0.88
168 0.86
169 0.85
170 0.84
171 0.84
172 0.83
173 0.8
174 0.74
175 0.75
176 0.72
177 0.65
178 0.6
179 0.58
180 0.58
181 0.64
182 0.71
183 0.71
184 0.74
185 0.77
186 0.78
187 0.73
188 0.64
189 0.57
190 0.49
191 0.38
192 0.29
193 0.23
194 0.2
195 0.16
196 0.17
197 0.18
198 0.21
199 0.24
200 0.26
201 0.28
202 0.29
203 0.31
204 0.31
205 0.36
206 0.36
207 0.36
208 0.37
209 0.37
210 0.35
211 0.36
212 0.35