Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UMG4

Protein Details
Accession A0A0C9UMG4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20RTTRTRRNGASRRDRDRTRABasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 14.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences RTTRTRRNGASRRDRDRTRAAAQTRDERERDSPRQDDQDDDDRSPTSPNSRRSNQTPAPAPRRTDLLNVDAIFSAHSDGFIVVLRKAVVHDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.76
3 0.75
4 0.71
5 0.66
6 0.64
7 0.59
8 0.57
9 0.57
10 0.59
11 0.57
12 0.55
13 0.5
14 0.45
15 0.48
16 0.49
17 0.5
18 0.48
19 0.45
20 0.43
21 0.48
22 0.46
23 0.41
24 0.38
25 0.4
26 0.36
27 0.33
28 0.3
29 0.25
30 0.24
31 0.23
32 0.19
33 0.18
34 0.22
35 0.29
36 0.35
37 0.39
38 0.43
39 0.46
40 0.55
41 0.51
42 0.51
43 0.51
44 0.53
45 0.56
46 0.56
47 0.54
48 0.46
49 0.45
50 0.4
51 0.37
52 0.31
53 0.26
54 0.27
55 0.25
56 0.25
57 0.22
58 0.2
59 0.16
60 0.13
61 0.12
62 0.07
63 0.07
64 0.07
65 0.06
66 0.07
67 0.09
68 0.11
69 0.09
70 0.11
71 0.11
72 0.11