Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UPG8

Protein Details
Accession A0A0C9UPG8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-77PSTPTKRSPSKRPSKSPAKSPRKPKADHydrophilic
NLS Segment(s)
PositionSequence
56-75KRSPSKRPSKSPAKSPRKPK
Subcellular Location(s) cyto 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036895  Uracil-DNA_glycosylase-like_sf  
Gene Ontology GO:0019104  F:DNA N-glycosylase activity  
Amino Acid Sequences IVCFVGKGIWQIVEAAFKKKLLEGSLAGASVDIRKLEDDILKGEGGEEILPSTPTKRSPSKRPSKSPAKSPRKPKADGYGLQPYKFVYADVMKDDTVKTEPNDAGDHDVVEETKETLFFVSPSSSARVVSHQLQDKAKILAELGADLAKVKAKAMDTSQMAVIPIDSWMPLNGAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.24
4 0.24
5 0.24
6 0.25
7 0.28
8 0.22
9 0.24
10 0.2
11 0.23
12 0.23
13 0.22
14 0.2
15 0.16
16 0.15
17 0.12
18 0.12
19 0.08
20 0.08
21 0.08
22 0.09
23 0.11
24 0.13
25 0.13
26 0.14
27 0.16
28 0.15
29 0.14
30 0.14
31 0.11
32 0.09
33 0.08
34 0.06
35 0.05
36 0.06
37 0.07
38 0.07
39 0.08
40 0.1
41 0.13
42 0.19
43 0.27
44 0.34
45 0.43
46 0.54
47 0.63
48 0.7
49 0.76
50 0.8
51 0.82
52 0.8
53 0.8
54 0.81
55 0.8
56 0.78
57 0.8
58 0.81
59 0.77
60 0.75
61 0.68
62 0.66
63 0.62
64 0.56
65 0.52
66 0.52
67 0.47
68 0.43
69 0.4
70 0.31
71 0.25
72 0.23
73 0.17
74 0.09
75 0.09
76 0.09
77 0.11
78 0.12
79 0.1
80 0.11
81 0.11
82 0.11
83 0.1
84 0.11
85 0.1
86 0.13
87 0.13
88 0.14
89 0.15
90 0.14
91 0.16
92 0.15
93 0.14
94 0.11
95 0.11
96 0.09
97 0.09
98 0.08
99 0.05
100 0.05
101 0.06
102 0.05
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.08
109 0.09
110 0.12
111 0.12
112 0.13
113 0.13
114 0.15
115 0.18
116 0.21
117 0.26
118 0.29
119 0.34
120 0.35
121 0.37
122 0.36
123 0.34
124 0.31
125 0.25
126 0.19
127 0.16
128 0.15
129 0.12
130 0.1
131 0.09
132 0.08
133 0.09
134 0.09
135 0.09
136 0.09
137 0.09
138 0.12
139 0.13
140 0.17
141 0.19
142 0.26
143 0.25
144 0.27
145 0.27
146 0.25
147 0.24
148 0.2
149 0.18
150 0.11
151 0.09
152 0.08
153 0.07
154 0.07
155 0.07