Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ULU9

Protein Details
Accession A0A0C9ULU9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-63PSTSSYIRRTQRNKRGQKKRISGGRRHydrophilic
NLS Segment(s)
PositionSequence
47-64TQRNKRGQKKRISGGRRV
Subcellular Location(s) nucl 12.5, cyto_nucl 11, mito 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MQSAGHEDQPSMFHAALMTDVVQPENKKAKYRSISIFPSTSSYIRRTQRNKRGQKKRISGGRRVKLSVVGSSSDIGMRMSSGLRWRRLHSDVDDINESLGELDMKMKHPTQSQKPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.11
5 0.1
6 0.08
7 0.09
8 0.09
9 0.12
10 0.13
11 0.19
12 0.27
13 0.28
14 0.33
15 0.36
16 0.44
17 0.47
18 0.52
19 0.51
20 0.5
21 0.52
22 0.49
23 0.47
24 0.38
25 0.37
26 0.33
27 0.29
28 0.25
29 0.23
30 0.27
31 0.31
32 0.39
33 0.44
34 0.53
35 0.62
36 0.69
37 0.77
38 0.8
39 0.86
40 0.86
41 0.87
42 0.84
43 0.82
44 0.81
45 0.75
46 0.74
47 0.73
48 0.71
49 0.64
50 0.57
51 0.49
52 0.44
53 0.4
54 0.32
55 0.23
56 0.17
57 0.15
58 0.15
59 0.14
60 0.11
61 0.1
62 0.08
63 0.06
64 0.05
65 0.05
66 0.05
67 0.07
68 0.14
69 0.2
70 0.27
71 0.3
72 0.33
73 0.38
74 0.41
75 0.44
76 0.4
77 0.43
78 0.38
79 0.4
80 0.39
81 0.33
82 0.3
83 0.25
84 0.22
85 0.13
86 0.11
87 0.07
88 0.05
89 0.09
90 0.11
91 0.13
92 0.17
93 0.19
94 0.23
95 0.3
96 0.4