Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9UB79

Protein Details
Accession A0A0C9UB79    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
55-74VEFARKKNGPRYRVRVKKEVBasic
NLS Segment(s)
PositionSequence
50-52KKA
56-71EFARKKNGPRYRVRVK
Subcellular Location(s) cyto 22, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR012132  GMC_OxRdtase  
IPR000172  GMC_OxRdtase_N  
IPR007867  GMC_OxRtase_C  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0016614  F:oxidoreductase activity, acting on CH-OH group of donors  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF05199  GMC_oxred_C  
PF00732  GMC_oxred_N  
PROSITE View protein in PROSITE  
PS00624  GMC_OXRED_2  
Amino Acid Sequences RLVTYIDEAGRRVTTESAYLTPDVLKRPNLKVAIFSQVTKIIFDTTGGKKKAVGVEFARKKNGPRYRVRVKKEVVVAAGAIHSPHILLLSGIGPKDELDKHNIPLVHELPGVGKHLQDHPVVNTRISVKPGHSIQYIAATKGLALFKMIGAFVKWGLTGGGPMTTNVTEVAAFIRSDDPKLFSKDKYDIKDVTSAPGAPDLELILVPIGFTAHGHGPVPSGELITMGAILLRPESKGAVTLKSADPFEAPIIDPHYLESPNDVAILVRGLKALIKIAKTEPFASNVNQNSNPLLDHDLGSLSDDDLEKEVRKRVETLYHPTSTCRMAPLEEEGVVNPDLKVYGLENVRVVDASIFPSIVAGHTAAPTIAIGEKAADIIKAALAAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.2
4 0.2
5 0.22
6 0.21
7 0.2
8 0.22
9 0.24
10 0.26
11 0.27
12 0.32
13 0.35
14 0.4
15 0.47
16 0.47
17 0.45
18 0.45
19 0.43
20 0.45
21 0.41
22 0.37
23 0.32
24 0.33
25 0.33
26 0.28
27 0.26
28 0.19
29 0.17
30 0.18
31 0.22
32 0.25
33 0.33
34 0.34
35 0.33
36 0.33
37 0.38
38 0.43
39 0.38
40 0.37
41 0.34
42 0.43
43 0.52
44 0.55
45 0.56
46 0.51
47 0.54
48 0.59
49 0.61
50 0.59
51 0.6
52 0.66
53 0.71
54 0.79
55 0.81
56 0.8
57 0.74
58 0.73
59 0.68
60 0.62
61 0.52
62 0.43
63 0.36
64 0.27
65 0.24
66 0.17
67 0.11
68 0.08
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.04
75 0.05
76 0.07
77 0.09
78 0.09
79 0.09
80 0.08
81 0.09
82 0.13
83 0.15
84 0.15
85 0.21
86 0.24
87 0.25
88 0.29
89 0.3
90 0.27
91 0.3
92 0.29
93 0.24
94 0.21
95 0.2
96 0.17
97 0.17
98 0.19
99 0.13
100 0.13
101 0.12
102 0.15
103 0.18
104 0.19
105 0.2
106 0.2
107 0.28
108 0.28
109 0.26
110 0.25
111 0.26
112 0.26
113 0.27
114 0.25
115 0.19
116 0.23
117 0.25
118 0.26
119 0.23
120 0.22
121 0.2
122 0.26
123 0.25
124 0.2
125 0.19
126 0.15
127 0.15
128 0.18
129 0.17
130 0.09
131 0.09
132 0.09
133 0.08
134 0.09
135 0.09
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.06
149 0.06
150 0.07
151 0.07
152 0.07
153 0.07
154 0.07
155 0.06
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.09
162 0.09
163 0.11
164 0.11
165 0.13
166 0.15
167 0.2
168 0.22
169 0.2
170 0.23
171 0.29
172 0.34
173 0.35
174 0.36
175 0.32
176 0.31
177 0.36
178 0.32
179 0.27
180 0.22
181 0.19
182 0.15
183 0.16
184 0.14
185 0.08
186 0.08
187 0.07
188 0.06
189 0.06
190 0.06
191 0.04
192 0.03
193 0.03
194 0.03
195 0.03
196 0.02
197 0.03
198 0.04
199 0.05
200 0.06
201 0.06
202 0.06
203 0.07
204 0.07
205 0.09
206 0.07
207 0.06
208 0.06
209 0.06
210 0.06
211 0.05
212 0.05
213 0.03
214 0.03
215 0.03
216 0.03
217 0.04
218 0.04
219 0.04
220 0.05
221 0.06
222 0.06
223 0.09
224 0.11
225 0.12
226 0.12
227 0.15
228 0.16
229 0.18
230 0.18
231 0.15
232 0.14
233 0.13
234 0.13
235 0.11
236 0.1
237 0.09
238 0.12
239 0.12
240 0.11
241 0.11
242 0.13
243 0.13
244 0.12
245 0.13
246 0.11
247 0.1
248 0.1
249 0.09
250 0.07
251 0.07
252 0.08
253 0.07
254 0.06
255 0.06
256 0.06
257 0.07
258 0.08
259 0.11
260 0.13
261 0.13
262 0.15
263 0.18
264 0.22
265 0.24
266 0.27
267 0.24
268 0.24
269 0.26
270 0.25
271 0.29
272 0.28
273 0.31
274 0.28
275 0.28
276 0.26
277 0.24
278 0.23
279 0.18
280 0.19
281 0.15
282 0.14
283 0.14
284 0.13
285 0.13
286 0.14
287 0.12
288 0.09
289 0.09
290 0.09
291 0.09
292 0.1
293 0.12
294 0.13
295 0.16
296 0.22
297 0.23
298 0.24
299 0.26
300 0.29
301 0.36
302 0.39
303 0.44
304 0.46
305 0.47
306 0.46
307 0.45
308 0.44
309 0.38
310 0.34
311 0.28
312 0.22
313 0.2
314 0.21
315 0.24
316 0.23
317 0.21
318 0.2
319 0.18
320 0.19
321 0.19
322 0.17
323 0.12
324 0.1
325 0.1
326 0.09
327 0.1
328 0.08
329 0.14
330 0.15
331 0.17
332 0.18
333 0.18
334 0.19
335 0.18
336 0.17
337 0.12
338 0.11
339 0.12
340 0.12
341 0.11
342 0.1
343 0.11
344 0.1
345 0.1
346 0.1
347 0.08
348 0.09
349 0.09
350 0.1
351 0.09
352 0.09
353 0.08
354 0.08
355 0.09
356 0.08
357 0.08
358 0.08
359 0.08
360 0.09
361 0.1
362 0.09
363 0.08
364 0.08
365 0.09
366 0.08