Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9UJ07

Protein Details
Accession A0A0C9UJ07    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-34GSPPYSPPSEKKERNRLKRRVKFRFTQSDLHydrophilic
NLS Segment(s)
PositionSequence
15-26KKERNRLKRRVK
Subcellular Location(s) nucl 17, cyto_nucl 13.333, mito_nucl 10.499, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MPYVGSPPYSPPSEKKERNRLKRRVKFRFTQSDLVMAINEKDSTKWELVNVRSTFPYWMVDEYVAVYAVRCANGRRRFCTDEDIKSLCELLCSSLVLNKRDRSPGIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.67
4 0.74
5 0.82
6 0.88
7 0.9
8 0.91
9 0.91
10 0.92
11 0.92
12 0.88
13 0.85
14 0.84
15 0.84
16 0.78
17 0.75
18 0.64
19 0.57
20 0.5
21 0.42
22 0.32
23 0.22
24 0.16
25 0.11
26 0.11
27 0.07
28 0.07
29 0.09
30 0.12
31 0.12
32 0.12
33 0.13
34 0.18
35 0.19
36 0.27
37 0.26
38 0.24
39 0.23
40 0.24
41 0.22
42 0.18
43 0.18
44 0.1
45 0.1
46 0.1
47 0.09
48 0.09
49 0.09
50 0.08
51 0.07
52 0.06
53 0.05
54 0.06
55 0.07
56 0.08
57 0.08
58 0.1
59 0.19
60 0.28
61 0.33
62 0.37
63 0.43
64 0.46
65 0.48
66 0.54
67 0.51
68 0.48
69 0.49
70 0.46
71 0.4
72 0.36
73 0.35
74 0.26
75 0.21
76 0.16
77 0.12
78 0.11
79 0.11
80 0.11
81 0.14
82 0.2
83 0.22
84 0.28
85 0.31
86 0.34
87 0.4