Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9THD9

Protein Details
Accession A0A0C9THD9    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-46VATGKKITPKRQRNEEHRLGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 13.5, nucl 8
Family & Domain DBs
Amino Acid Sequences MKLSGPCAGVENTIYYAAYVYFEKVRVATGKKITPKRQRNEEHRLGMPLVDRRHVLVFMAKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.1
4 0.09
5 0.09
6 0.08
7 0.08
8 0.09
9 0.09
10 0.1
11 0.1
12 0.11
13 0.13
14 0.15
15 0.18
16 0.21
17 0.25
18 0.33
19 0.4
20 0.48
21 0.56
22 0.62
23 0.66
24 0.72
25 0.77
26 0.78
27 0.8
28 0.79
29 0.74
30 0.66
31 0.61
32 0.51
33 0.43
34 0.38
35 0.35
36 0.29
37 0.26
38 0.24
39 0.24
40 0.26
41 0.25
42 0.22