Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VWI5

Protein Details
Accession A0A0C9VWI5    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-24GKAIPVDIKKRRKVQEQEDKLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 11.833, nucl 9, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF05225  HTH_psq  
Amino Acid Sequences MVGKAIPVDIKKRRKVQEQEDKLLAAAAEVIEEHDKPKAKHCSIRSIATIYEVSSSTLSRHVNGGCSAKNFNVLRQKLSTAEEDVLVKIICELADQGFPASCQRVTDMAESILKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.81
4 0.83
5 0.82
6 0.8
7 0.73
8 0.65
9 0.55
10 0.45
11 0.34
12 0.22
13 0.14
14 0.07
15 0.05
16 0.04
17 0.06
18 0.06
19 0.07
20 0.07
21 0.11
22 0.15
23 0.15
24 0.24
25 0.32
26 0.35
27 0.42
28 0.45
29 0.51
30 0.51
31 0.54
32 0.47
33 0.39
34 0.36
35 0.3
36 0.27
37 0.17
38 0.15
39 0.11
40 0.1
41 0.09
42 0.09
43 0.08
44 0.11
45 0.11
46 0.1
47 0.12
48 0.12
49 0.13
50 0.15
51 0.17
52 0.14
53 0.16
54 0.17
55 0.15
56 0.22
57 0.21
58 0.24
59 0.31
60 0.31
61 0.32
62 0.32
63 0.34
64 0.28
65 0.3
66 0.27
67 0.2
68 0.2
69 0.18
70 0.17
71 0.16
72 0.15
73 0.12
74 0.1
75 0.08
76 0.07
77 0.06
78 0.06
79 0.07
80 0.07
81 0.08
82 0.08
83 0.09
84 0.09
85 0.09
86 0.12
87 0.14
88 0.13
89 0.13
90 0.15
91 0.17
92 0.2
93 0.22
94 0.21
95 0.21