Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VK22

Protein Details
Accession A0A0C9VK22    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
314-334LASREKSKIENEQRQRRKDELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 7.833, mito 7.5, cyto_mito 6.833, cyto 5, pero 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037239  OSBP_sf  
IPR000648  Oxysterol-bd  
IPR018494  Oxysterol-bd_CS  
Gene Ontology GO:0008289  F:lipid binding  
Pfam View protein in Pfam  
PF01237  Oxysterol_BP  
PROSITE View protein in PROSITE  
PS01013  OSBP  
Amino Acid Sequences MSNSNEEAGEAVPASQRGSWTAFIKAIASFSGDLSSLTAPPFILSPISLTEFPAYWAERPELFSAIADAKNAESRMLAVLKWFISTLKGQYTSRNDQMGSEKKPLNPVLGELFYGHWPDRNGRGETRLLVEQVSHHPPITAYMITNKAKKLALQGHSAQKTSFSAGSIIVKQLGHAILNVELPDGSKEQYLITLPRLRIDGIWYGSPYIELTDTSYIQSSSGWLSTIEYKGKGYFSGKTHSFKAVVTGPNSTSTKHTIEGQWHTTSKMSGVPFHDVQGPKEEVTVATAEEQTEWESRKLWNLVAKGIREGDYELASREKSKIENEQRQRRKDELAAGAPWQLKHFVHASNDPDYERLAKMCKVQPTTEDCYVYQGNGPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.15
5 0.18
6 0.21
7 0.21
8 0.24
9 0.24
10 0.23
11 0.24
12 0.22
13 0.19
14 0.15
15 0.16
16 0.13
17 0.12
18 0.13
19 0.11
20 0.11
21 0.12
22 0.13
23 0.11
24 0.11
25 0.11
26 0.1
27 0.1
28 0.11
29 0.09
30 0.09
31 0.08
32 0.09
33 0.11
34 0.15
35 0.15
36 0.16
37 0.16
38 0.16
39 0.17
40 0.2
41 0.19
42 0.17
43 0.19
44 0.2
45 0.2
46 0.23
47 0.23
48 0.21
49 0.19
50 0.18
51 0.18
52 0.19
53 0.18
54 0.15
55 0.14
56 0.13
57 0.16
58 0.17
59 0.14
60 0.11
61 0.11
62 0.14
63 0.15
64 0.13
65 0.11
66 0.14
67 0.14
68 0.14
69 0.13
70 0.1
71 0.12
72 0.14
73 0.16
74 0.18
75 0.22
76 0.22
77 0.29
78 0.37
79 0.41
80 0.43
81 0.43
82 0.38
83 0.36
84 0.44
85 0.44
86 0.41
87 0.41
88 0.41
89 0.4
90 0.46
91 0.44
92 0.39
93 0.32
94 0.29
95 0.26
96 0.23
97 0.22
98 0.16
99 0.16
100 0.14
101 0.16
102 0.14
103 0.13
104 0.13
105 0.16
106 0.22
107 0.26
108 0.28
109 0.28
110 0.31
111 0.31
112 0.31
113 0.31
114 0.25
115 0.2
116 0.17
117 0.16
118 0.15
119 0.18
120 0.21
121 0.18
122 0.17
123 0.17
124 0.17
125 0.18
126 0.18
127 0.14
128 0.1
129 0.13
130 0.2
131 0.22
132 0.25
133 0.23
134 0.24
135 0.23
136 0.24
137 0.27
138 0.29
139 0.29
140 0.31
141 0.35
142 0.41
143 0.42
144 0.42
145 0.34
146 0.28
147 0.26
148 0.23
149 0.18
150 0.11
151 0.1
152 0.1
153 0.12
154 0.11
155 0.11
156 0.11
157 0.1
158 0.1
159 0.1
160 0.1
161 0.08
162 0.07
163 0.08
164 0.07
165 0.07
166 0.07
167 0.06
168 0.05
169 0.05
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.07
177 0.08
178 0.08
179 0.11
180 0.15
181 0.15
182 0.16
183 0.16
184 0.16
185 0.15
186 0.16
187 0.16
188 0.13
189 0.14
190 0.12
191 0.12
192 0.12
193 0.12
194 0.09
195 0.07
196 0.06
197 0.05
198 0.07
199 0.08
200 0.08
201 0.09
202 0.09
203 0.08
204 0.08
205 0.08
206 0.07
207 0.07
208 0.06
209 0.06
210 0.06
211 0.07
212 0.1
213 0.12
214 0.13
215 0.13
216 0.13
217 0.14
218 0.15
219 0.15
220 0.15
221 0.17
222 0.18
223 0.24
224 0.27
225 0.29
226 0.31
227 0.31
228 0.3
229 0.25
230 0.26
231 0.25
232 0.25
233 0.23
234 0.23
235 0.22
236 0.26
237 0.27
238 0.24
239 0.21
240 0.22
241 0.22
242 0.22
243 0.23
244 0.21
245 0.27
246 0.31
247 0.32
248 0.32
249 0.31
250 0.31
251 0.29
252 0.26
253 0.21
254 0.21
255 0.17
256 0.17
257 0.19
258 0.24
259 0.23
260 0.24
261 0.3
262 0.26
263 0.26
264 0.29
265 0.28
266 0.22
267 0.22
268 0.21
269 0.15
270 0.16
271 0.15
272 0.09
273 0.09
274 0.1
275 0.1
276 0.09
277 0.1
278 0.11
279 0.13
280 0.15
281 0.14
282 0.15
283 0.16
284 0.22
285 0.23
286 0.24
287 0.26
288 0.26
289 0.32
290 0.35
291 0.35
292 0.32
293 0.32
294 0.3
295 0.26
296 0.26
297 0.21
298 0.18
299 0.17
300 0.16
301 0.17
302 0.17
303 0.17
304 0.18
305 0.18
306 0.19
307 0.24
308 0.33
309 0.41
310 0.51
311 0.6
312 0.69
313 0.76
314 0.81
315 0.82
316 0.75
317 0.71
318 0.66
319 0.63
320 0.6
321 0.55
322 0.49
323 0.44
324 0.45
325 0.41
326 0.37
327 0.3
328 0.26
329 0.21
330 0.23
331 0.25
332 0.24
333 0.28
334 0.33
335 0.35
336 0.37
337 0.39
338 0.37
339 0.34
340 0.32
341 0.29
342 0.25
343 0.24
344 0.23
345 0.24
346 0.31
347 0.36
348 0.42
349 0.44
350 0.44
351 0.48
352 0.52
353 0.56
354 0.54
355 0.51
356 0.43
357 0.45
358 0.43
359 0.37