A0A0C9UB96

UniProt ID: A0A0C9UB96   Organism: Sphaerobolus stellatus (strain SS14)
Gene: M422DRAFT_90657   Protein: Unplaced genomic scaffold SPHSTscaffold_1241, whole genome shotgun sequence (Fragment)
Length: 92 AA

Protein Details

• Accession: A0A0C9UB96
• Localization Confidence: Low
• Confidence Score: 7.2
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  38-57	YGEWWHRHRRAMHNKFHPRA	Basic

• Subcellular Location(s): mito 14.5, mito_nucl 12, nucl 8.5, cyto 3
• Family & Domain DBs:
  • InterPro:
    • IPR036396 Cyt_P450_sf
  • Gene Ontology:
    • GO:0020037 F:heme binding
    • GO:0005506 F:iron ion binding
    • GO:0004497 F:monooxygenase activity
    • GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• Amino Acid Sequences: LVFLNSRRMVHELFERRSSNYSDRTTMGFGWSLAFHGYGEWWHRHRRAMHNKFHPRAVEAYKPIQIK

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.44
2, 0.43
3, 0.42
4, 0.44
5, 0.45
6, 0.4
7, 0.39
8, 0.37
9, 0.33
10, 0.33
11, 0.32
12, 0.31
13, 0.26
14, 0.22
15, 0.16
16, 0.13
17, 0.11
18, 0.1
19, 0.08
20, 0.07
21, 0.07
22, 0.06
23, 0.05
24, 0.05
25, 0.06
26, 0.09
27, 0.13
28, 0.16
29, 0.22
30, 0.24
31, 0.3
32, 0.36
33, 0.46
34, 0.54
35, 0.6
36, 0.67
37, 0.71
38, 0.8
39, 0.78
40, 0.77
41, 0.68
42, 0.59
43, 0.56
44, 0.52
45, 0.49
46, 0.44
47, 0.45