Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9T824

Protein Details
Accession A0A0C9T824    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-90GSQSSSSTSPRPRKFRRRHPHydrophilic
NLS Segment(s)
PositionSequence
81-90RPRKFRRRHP
Subcellular Location(s) extr 16, E.R. 4, golg 4, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNYLRIILILSNLLLLVYGSLIPVHVREKRDMTCSDGNCPDNFALGLEGVEQVLKDCQDCQGPALSVSDTGSQSSSSTSPRPRKFRRRHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.06
11 0.11
12 0.15
13 0.17
14 0.21
15 0.25
16 0.27
17 0.32
18 0.31
19 0.33
20 0.35
21 0.34
22 0.35
23 0.36
24 0.35
25 0.3
26 0.31
27 0.24
28 0.18
29 0.17
30 0.12
31 0.08
32 0.06
33 0.06
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.07
45 0.09
46 0.09
47 0.1
48 0.12
49 0.12
50 0.13
51 0.14
52 0.12
53 0.11
54 0.12
55 0.14
56 0.12
57 0.12
58 0.12
59 0.11
60 0.11
61 0.13
62 0.13
63 0.14
64 0.21
65 0.3
66 0.4
67 0.48
68 0.59
69 0.68
70 0.77