Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9V9D1

Protein Details
Accession A0A0C9V9D1   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-36GCEARRQIGKKFHCRNLPRRRPRYRHTARKIGGBasic
NLS Segment(s)
PositionSequence
20-31LPRRRPRYRHTA
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRGGCEARRQIGKKFHCRNLPRRRPRYRHTARKIGGMEDIPDRENLQTMSRIDIQKLCKVWLFALSAGKDVPRPHRAASERGTSQPPVSSRVPSTAQPPSPSKQLVESATKKAALQPSEANTDAESVASAPAGTTSTASTRRKVQAMQMRLGKGKPVADGGNGYSDSIFADNSCSAPLDNRLHGRRHRFVSTSTSNVSPGPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.76
4 0.82
5 0.85
6 0.86
7 0.88
8 0.88
9 0.89
10 0.92
11 0.91
12 0.88
13 0.89
14 0.89
15 0.89
16 0.87
17 0.87
18 0.78
19 0.77
20 0.72
21 0.62
22 0.55
23 0.45
24 0.38
25 0.3
26 0.3
27 0.22
28 0.21
29 0.2
30 0.16
31 0.16
32 0.15
33 0.13
34 0.16
35 0.16
36 0.19
37 0.24
38 0.24
39 0.25
40 0.29
41 0.3
42 0.31
43 0.31
44 0.29
45 0.25
46 0.25
47 0.24
48 0.22
49 0.2
50 0.17
51 0.21
52 0.19
53 0.18
54 0.18
55 0.18
56 0.17
57 0.18
58 0.22
59 0.22
60 0.24
61 0.25
62 0.32
63 0.35
64 0.37
65 0.38
66 0.38
67 0.35
68 0.36
69 0.37
70 0.3
71 0.28
72 0.26
73 0.23
74 0.21
75 0.21
76 0.2
77 0.18
78 0.21
79 0.22
80 0.2
81 0.23
82 0.23
83 0.23
84 0.25
85 0.27
86 0.26
87 0.28
88 0.27
89 0.23
90 0.2
91 0.22
92 0.21
93 0.25
94 0.26
95 0.26
96 0.26
97 0.26
98 0.25
99 0.25
100 0.26
101 0.2
102 0.19
103 0.19
104 0.2
105 0.23
106 0.24
107 0.21
108 0.17
109 0.17
110 0.14
111 0.11
112 0.09
113 0.06
114 0.05
115 0.05
116 0.04
117 0.03
118 0.04
119 0.04
120 0.04
121 0.05
122 0.05
123 0.09
124 0.17
125 0.19
126 0.21
127 0.27
128 0.3
129 0.32
130 0.33
131 0.39
132 0.4
133 0.43
134 0.48
135 0.47
136 0.46
137 0.46
138 0.44
139 0.38
140 0.32
141 0.28
142 0.23
143 0.21
144 0.19
145 0.18
146 0.19
147 0.18
148 0.18
149 0.17
150 0.16
151 0.13
152 0.12
153 0.11
154 0.1
155 0.09
156 0.06
157 0.09
158 0.09
159 0.1
160 0.1
161 0.1
162 0.1
163 0.12
164 0.2
165 0.21
166 0.26
167 0.34
168 0.38
169 0.45
170 0.53
171 0.6
172 0.61
173 0.62
174 0.63
175 0.57
176 0.56
177 0.57
178 0.56
179 0.52
180 0.48
181 0.43
182 0.39