Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9TSB7

Protein Details
Accession A0A0C9TSB7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-90HLHHVPRKELWKRLRGKTRERVPGVWBasic
NLS Segment(s)
Subcellular Location(s) plas 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004713  CaH_exchang  
IPR004837  NaCa_Exmemb  
Gene Ontology GO:0016020  C:membrane  
GO:0015368  F:calcium:monoatomic cation antiporter activity  
Pfam View protein in Pfam  
PF01699  Na_Ca_ex  
Amino Acid Sequences MEKRSLSSTSQSATSTTSPVLIDSQGHRIPNPHTSPPDLEGQTNTNETANEAEPTYYENITNFIHLHHVPRKELWKRLRGKTRERVPGVWESLKAIFFNSCTLNIFLIVIPFAWAAHFQKEWPNHLIITFILCFVSLIPLEKMFDFGGEQMSLYMGKDLGDLLVVTLNNTVEATLGIILLKKCDLKLLQSTLSGVVLLHLLLVPGVAFLTGGARIWQQNLHPHPTQLNQTLLTIGVLSLLIPTAFFAALNPSVPSAIASAATGAANILVAESSGEALINDDLRDVFLRISRGMSILLLIVYVCSRFFLYNPPGDGNSLALPPDAPEELRRIEHELAHEEPKINPWVGWLLLAVTVAITGVTAEFLVSSIETVLEESNITQEWFGLVLLPLVSFSGDATVAIVYFLRTILFLKPEVPESLAKARAIDLSIQFTLFWMPFLVLLGWWINKPLTLLFDQFEVSVLIGACFLVNYVTADSKTNWAEGVILCAFYIMIVLTAWYYPGQLPIRQLLACPTVAEGLAEGVSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.2
4 0.2
5 0.17
6 0.18
7 0.18
8 0.16
9 0.18
10 0.18
11 0.26
12 0.27
13 0.28
14 0.28
15 0.3
16 0.33
17 0.39
18 0.42
19 0.42
20 0.42
21 0.46
22 0.49
23 0.48
24 0.52
25 0.44
26 0.4
27 0.35
28 0.34
29 0.32
30 0.3
31 0.28
32 0.21
33 0.19
34 0.18
35 0.19
36 0.18
37 0.16
38 0.15
39 0.14
40 0.13
41 0.16
42 0.18
43 0.15
44 0.15
45 0.14
46 0.16
47 0.16
48 0.18
49 0.15
50 0.13
51 0.17
52 0.18
53 0.25
54 0.29
55 0.33
56 0.34
57 0.39
58 0.49
59 0.51
60 0.59
61 0.6
62 0.63
63 0.68
64 0.75
65 0.8
66 0.79
67 0.83
68 0.83
69 0.84
70 0.85
71 0.81
72 0.73
73 0.68
74 0.67
75 0.62
76 0.54
77 0.45
78 0.38
79 0.35
80 0.33
81 0.28
82 0.22
83 0.17
84 0.14
85 0.17
86 0.15
87 0.14
88 0.15
89 0.16
90 0.16
91 0.15
92 0.15
93 0.12
94 0.11
95 0.1
96 0.08
97 0.07
98 0.07
99 0.07
100 0.06
101 0.09
102 0.1
103 0.13
104 0.13
105 0.14
106 0.21
107 0.25
108 0.29
109 0.3
110 0.3
111 0.27
112 0.27
113 0.27
114 0.19
115 0.19
116 0.15
117 0.11
118 0.1
119 0.09
120 0.09
121 0.08
122 0.1
123 0.07
124 0.09
125 0.09
126 0.1
127 0.11
128 0.11
129 0.12
130 0.1
131 0.1
132 0.09
133 0.09
134 0.1
135 0.09
136 0.09
137 0.07
138 0.08
139 0.07
140 0.07
141 0.07
142 0.05
143 0.05
144 0.06
145 0.06
146 0.05
147 0.05
148 0.05
149 0.04
150 0.06
151 0.06
152 0.06
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.05
159 0.05
160 0.05
161 0.04
162 0.04
163 0.04
164 0.07
165 0.07
166 0.07
167 0.09
168 0.09
169 0.09
170 0.12
171 0.13
172 0.14
173 0.2
174 0.23
175 0.23
176 0.22
177 0.23
178 0.2
179 0.19
180 0.16
181 0.1
182 0.07
183 0.06
184 0.05
185 0.04
186 0.04
187 0.03
188 0.03
189 0.03
190 0.03
191 0.02
192 0.02
193 0.02
194 0.02
195 0.02
196 0.03
197 0.03
198 0.03
199 0.04
200 0.05
201 0.06
202 0.07
203 0.09
204 0.1
205 0.18
206 0.21
207 0.26
208 0.26
209 0.26
210 0.28
211 0.29
212 0.31
213 0.26
214 0.25
215 0.2
216 0.19
217 0.18
218 0.16
219 0.13
220 0.09
221 0.06
222 0.04
223 0.04
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.05
235 0.06
236 0.07
237 0.07
238 0.06
239 0.06
240 0.06
241 0.07
242 0.05
243 0.05
244 0.05
245 0.04
246 0.04
247 0.05
248 0.05
249 0.04
250 0.04
251 0.03
252 0.03
253 0.03
254 0.03
255 0.02
256 0.02
257 0.02
258 0.02
259 0.02
260 0.02
261 0.03
262 0.03
263 0.03
264 0.04
265 0.04
266 0.04
267 0.04
268 0.04
269 0.05
270 0.05
271 0.05
272 0.06
273 0.07
274 0.08
275 0.09
276 0.1
277 0.09
278 0.09
279 0.09
280 0.08
281 0.07
282 0.06
283 0.05
284 0.04
285 0.04
286 0.04
287 0.04
288 0.04
289 0.03
290 0.04
291 0.05
292 0.05
293 0.06
294 0.12
295 0.16
296 0.18
297 0.2
298 0.21
299 0.2
300 0.21
301 0.2
302 0.15
303 0.13
304 0.1
305 0.09
306 0.07
307 0.07
308 0.07
309 0.08
310 0.07
311 0.06
312 0.07
313 0.1
314 0.12
315 0.13
316 0.14
317 0.17
318 0.18
319 0.19
320 0.2
321 0.21
322 0.22
323 0.24
324 0.23
325 0.2
326 0.19
327 0.2
328 0.21
329 0.17
330 0.15
331 0.13
332 0.14
333 0.13
334 0.13
335 0.1
336 0.07
337 0.07
338 0.07
339 0.06
340 0.04
341 0.04
342 0.03
343 0.03
344 0.02
345 0.02
346 0.02
347 0.03
348 0.03
349 0.03
350 0.03
351 0.03
352 0.03
353 0.03
354 0.04
355 0.04
356 0.04
357 0.04
358 0.05
359 0.05
360 0.05
361 0.05
362 0.05
363 0.06
364 0.06
365 0.07
366 0.06
367 0.06
368 0.06
369 0.06
370 0.06
371 0.05
372 0.05
373 0.05
374 0.06
375 0.05
376 0.05
377 0.05
378 0.05
379 0.04
380 0.04
381 0.05
382 0.04
383 0.04
384 0.05
385 0.05
386 0.05
387 0.05
388 0.05
389 0.04
390 0.05
391 0.05
392 0.05
393 0.05
394 0.07
395 0.09
396 0.11
397 0.11
398 0.13
399 0.14
400 0.17
401 0.17
402 0.18
403 0.17
404 0.2
405 0.25
406 0.26
407 0.25
408 0.23
409 0.23
410 0.22
411 0.22
412 0.21
413 0.17
414 0.19
415 0.19
416 0.19
417 0.17
418 0.16
419 0.17
420 0.14
421 0.12
422 0.08
423 0.08
424 0.08
425 0.09
426 0.09
427 0.06
428 0.08
429 0.09
430 0.1
431 0.1
432 0.12
433 0.11
434 0.11
435 0.12
436 0.12
437 0.14
438 0.15
439 0.17
440 0.16
441 0.17
442 0.17
443 0.16
444 0.16
445 0.12
446 0.1
447 0.1
448 0.09
449 0.08
450 0.08
451 0.08
452 0.07
453 0.06
454 0.06
455 0.04
456 0.05
457 0.06
458 0.08
459 0.1
460 0.11
461 0.14
462 0.15
463 0.2
464 0.21
465 0.2
466 0.18
467 0.16
468 0.18
469 0.16
470 0.2
471 0.15
472 0.14
473 0.13
474 0.13
475 0.13
476 0.1
477 0.1
478 0.04
479 0.04
480 0.04
481 0.04
482 0.05
483 0.05
484 0.07
485 0.06
486 0.08
487 0.08
488 0.16
489 0.19
490 0.21
491 0.25
492 0.28
493 0.32
494 0.3
495 0.31
496 0.28
497 0.28
498 0.26
499 0.23
500 0.2
501 0.17
502 0.17
503 0.16
504 0.11
505 0.1