Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VXF5

Protein Details
Accession A0A0C9VXF5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-27LISDPKRFKDRVKKEKIKRLSVFIHydrophilic
NLS Segment(s)
PositionSequence
10-21RFKDRVKKEKIK
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MKWLISDPKRFKDRVKKEKIKRLSVFICPPGEKLVNILGLVSISQQPEKSPPDSVQDHPGSHRLLATRPTGSSAEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.79
4 0.83
5 0.91
6 0.9
7 0.89
8 0.81
9 0.78
10 0.71
11 0.67
12 0.62
13 0.55
14 0.5
15 0.4
16 0.37
17 0.32
18 0.29
19 0.22
20 0.18
21 0.16
22 0.13
23 0.12
24 0.11
25 0.08
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.07
32 0.07
33 0.08
34 0.12
35 0.16
36 0.17
37 0.18
38 0.19
39 0.24
40 0.28
41 0.3
42 0.34
43 0.34
44 0.34
45 0.33
46 0.36
47 0.31
48 0.28
49 0.28
50 0.21
51 0.22
52 0.25
53 0.27
54 0.25
55 0.24
56 0.28