Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9V7D5

Protein Details
Accession A0A0C9V7D5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
23-44PLPVTPKKPKGCRANNKHSPSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 13.666, mito 11.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MSSMPKHTRASARVSACNKAPSPLPVTPKKPKGCRANNKHSPSPSVGLPITPASQPRSNGKRSRKNDEVTIISSDDEIVQINKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.48
4 0.5
5 0.43
6 0.37
7 0.34
8 0.28
9 0.31
10 0.32
11 0.35
12 0.37
13 0.44
14 0.51
15 0.58
16 0.63
17 0.64
18 0.68
19 0.71
20 0.75
21 0.78
22 0.79
23 0.81
24 0.83
25 0.82
26 0.79
27 0.69
28 0.62
29 0.53
30 0.45
31 0.35
32 0.28
33 0.21
34 0.16
35 0.16
36 0.14
37 0.13
38 0.12
39 0.13
40 0.15
41 0.18
42 0.2
43 0.28
44 0.33
45 0.4
46 0.48
47 0.56
48 0.63
49 0.66
50 0.73
51 0.73
52 0.71
53 0.69
54 0.67
55 0.61
56 0.53
57 0.49
58 0.41
59 0.33
60 0.28
61 0.22
62 0.16
63 0.12
64 0.1