Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VSR7

Protein Details
Accession A0A0C9VSR7    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-70KGGKGKERRRQNREYLPKRSBasic
NLS Segment(s)
PositionSequence
49-63REKGGKGKERRRQNR
Subcellular Location(s) mito 17, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MSITSALVPPSTSALTPPTQAPPGGRRNGQCLPSLILDYTVSSAGDHEREKGGKGKERRRQNREYLPKRSDKCKGIIFKSIWEERVGEIDHGHRVNMIDALFGVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.17
4 0.18
5 0.19
6 0.2
7 0.21
8 0.23
9 0.27
10 0.33
11 0.37
12 0.39
13 0.37
14 0.42
15 0.46
16 0.45
17 0.4
18 0.34
19 0.32
20 0.28
21 0.27
22 0.2
23 0.16
24 0.14
25 0.12
26 0.11
27 0.08
28 0.07
29 0.06
30 0.07
31 0.07
32 0.09
33 0.09
34 0.09
35 0.11
36 0.11
37 0.12
38 0.18
39 0.2
40 0.25
41 0.33
42 0.42
43 0.48
44 0.59
45 0.68
46 0.7
47 0.74
48 0.76
49 0.78
50 0.8
51 0.81
52 0.79
53 0.75
54 0.76
55 0.72
56 0.7
57 0.67
58 0.59
59 0.56
60 0.55
61 0.55
62 0.5
63 0.55
64 0.49
65 0.47
66 0.5
67 0.47
68 0.41
69 0.35
70 0.32
71 0.25
72 0.27
73 0.24
74 0.17
75 0.16
76 0.17
77 0.22
78 0.21
79 0.2
80 0.18
81 0.17
82 0.18
83 0.19
84 0.16
85 0.11