Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UAR7

Protein Details
Accession A0A0C9UAR7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
153-173SIPPLHSRRRSTQRRLLSNMLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR015496  Ubiquilin  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019956  Ubiquitin_dom  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd16106  Ubl_Dsk2p_like  
Amino Acid Sequences MSSSTSTDATSQISINIEGPSEPKIQISIAADKTVMDLKRAIAEKLDVEADRQRLIFSGKLLKDDDVLSSYKIKSGHTIHMVKGAAHNNVTASTSTPQPLPAMQAGQNASDPLTLLNSYMGHVAMAGVNLSAGLGFNPNGPKMELPRNARLSSIPPLHSRRRSTQRRLLSNMLYLQEDIYECMQASYSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.13
5 0.12
6 0.13
7 0.15
8 0.15
9 0.15
10 0.14
11 0.14
12 0.14
13 0.17
14 0.19
15 0.22
16 0.21
17 0.22
18 0.21
19 0.2
20 0.22
21 0.24
22 0.21
23 0.15
24 0.15
25 0.15
26 0.21
27 0.22
28 0.21
29 0.17
30 0.18
31 0.17
32 0.18
33 0.19
34 0.13
35 0.14
36 0.18
37 0.18
38 0.18
39 0.18
40 0.16
41 0.15
42 0.17
43 0.16
44 0.14
45 0.21
46 0.2
47 0.22
48 0.23
49 0.23
50 0.22
51 0.21
52 0.19
53 0.13
54 0.13
55 0.12
56 0.14
57 0.13
58 0.15
59 0.15
60 0.14
61 0.18
62 0.2
63 0.24
64 0.28
65 0.3
66 0.28
67 0.32
68 0.32
69 0.27
70 0.28
71 0.25
72 0.19
73 0.17
74 0.17
75 0.13
76 0.13
77 0.13
78 0.09
79 0.08
80 0.08
81 0.09
82 0.1
83 0.09
84 0.09
85 0.09
86 0.09
87 0.09
88 0.09
89 0.1
90 0.1
91 0.13
92 0.13
93 0.13
94 0.13
95 0.11
96 0.11
97 0.09
98 0.08
99 0.05
100 0.06
101 0.05
102 0.05
103 0.06
104 0.06
105 0.07
106 0.07
107 0.07
108 0.05
109 0.05
110 0.05
111 0.05
112 0.04
113 0.04
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.02
120 0.03
121 0.04
122 0.04
123 0.07
124 0.09
125 0.1
126 0.11
127 0.12
128 0.13
129 0.17
130 0.26
131 0.31
132 0.35
133 0.43
134 0.47
135 0.47
136 0.46
137 0.43
138 0.39
139 0.39
140 0.39
141 0.33
142 0.35
143 0.41
144 0.5
145 0.56
146 0.58
147 0.6
148 0.66
149 0.73
150 0.76
151 0.79
152 0.8
153 0.8
154 0.81
155 0.77
156 0.7
157 0.65
158 0.59
159 0.51
160 0.43
161 0.34
162 0.28
163 0.23
164 0.2
165 0.17
166 0.13
167 0.12
168 0.11
169 0.11