Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9TUI1

Protein Details
Accession A0A0C9TUI1    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26KVRAEVSKRERRIRKQEKALEAKQPNHydrophilic
NLS Segment(s)
PositionSequence
9-15RERRIRK
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010935  SMC_hinge  
IPR036277  SMC_hinge_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0005524  F:ATP binding  
GO:0051276  P:chromosome organization  
Pfam View protein in Pfam  
PF06470  SMC_hinge  
Amino Acid Sequences KVRAEVSKRERRIRKQEKALEAKQPNMVKIEAQIAHSERRLRSVNDLAESVRKDEEKQQEKVDRLRNELESVQKAANAAQEASRQAASQTLSLSEDSLKEYRELKAKANVQEVQSRQQLETLRRDEKTQSRSLTTINEKVGHFEERKLKLDEDKITLSTRKAELEEKLENVQAELKTAKRELENAQSERTRVTKLEAELNEKLQECHVKLLQAGVDQKESEKEAKRKEVFASLQRIFPGVRGRVIDLCEPTQRKYETAVSVVLGRNIDALVVDHEKTAIDCIEYMRNQRAGQATFIPLDTIQIKPINDKYRNFQKGARLALD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.9
4 0.9
5 0.9
6 0.85
7 0.84
8 0.78
9 0.71
10 0.68
11 0.61
12 0.53
13 0.46
14 0.41
15 0.31
16 0.28
17 0.32
18 0.26
19 0.24
20 0.27
21 0.27
22 0.3
23 0.33
24 0.37
25 0.31
26 0.35
27 0.38
28 0.35
29 0.39
30 0.43
31 0.43
32 0.39
33 0.4
34 0.35
35 0.37
36 0.36
37 0.31
38 0.26
39 0.23
40 0.23
41 0.3
42 0.39
43 0.41
44 0.43
45 0.5
46 0.53
47 0.57
48 0.63
49 0.63
50 0.56
51 0.55
52 0.56
53 0.49
54 0.46
55 0.44
56 0.42
57 0.35
58 0.34
59 0.29
60 0.25
61 0.23
62 0.21
63 0.2
64 0.16
65 0.14
66 0.13
67 0.15
68 0.15
69 0.16
70 0.16
71 0.13
72 0.12
73 0.14
74 0.14
75 0.12
76 0.12
77 0.11
78 0.12
79 0.12
80 0.13
81 0.11
82 0.1
83 0.13
84 0.13
85 0.13
86 0.14
87 0.15
88 0.18
89 0.24
90 0.26
91 0.26
92 0.33
93 0.38
94 0.4
95 0.44
96 0.44
97 0.39
98 0.43
99 0.42
100 0.39
101 0.37
102 0.33
103 0.28
104 0.29
105 0.3
106 0.29
107 0.34
108 0.35
109 0.36
110 0.35
111 0.37
112 0.39
113 0.42
114 0.44
115 0.42
116 0.38
117 0.36
118 0.36
119 0.36
120 0.36
121 0.33
122 0.31
123 0.27
124 0.28
125 0.26
126 0.27
127 0.28
128 0.26
129 0.22
130 0.23
131 0.29
132 0.29
133 0.33
134 0.33
135 0.32
136 0.31
137 0.35
138 0.34
139 0.29
140 0.26
141 0.24
142 0.24
143 0.24
144 0.21
145 0.18
146 0.17
147 0.14
148 0.15
149 0.16
150 0.16
151 0.19
152 0.2
153 0.18
154 0.19
155 0.19
156 0.17
157 0.15
158 0.16
159 0.12
160 0.12
161 0.12
162 0.11
163 0.12
164 0.13
165 0.15
166 0.12
167 0.15
168 0.17
169 0.24
170 0.3
171 0.3
172 0.33
173 0.32
174 0.32
175 0.3
176 0.29
177 0.22
178 0.16
179 0.17
180 0.17
181 0.18
182 0.25
183 0.25
184 0.29
185 0.29
186 0.3
187 0.29
188 0.26
189 0.25
190 0.19
191 0.22
192 0.17
193 0.19
194 0.19
195 0.17
196 0.16
197 0.18
198 0.17
199 0.16
200 0.18
201 0.16
202 0.16
203 0.15
204 0.16
205 0.16
206 0.17
207 0.2
208 0.25
209 0.3
210 0.35
211 0.44
212 0.46
213 0.48
214 0.47
215 0.49
216 0.46
217 0.46
218 0.49
219 0.4
220 0.4
221 0.37
222 0.36
223 0.29
224 0.27
225 0.28
226 0.21
227 0.22
228 0.21
229 0.23
230 0.25
231 0.27
232 0.28
233 0.23
234 0.24
235 0.29
236 0.3
237 0.3
238 0.34
239 0.33
240 0.3
241 0.32
242 0.35
243 0.31
244 0.3
245 0.29
246 0.24
247 0.26
248 0.26
249 0.24
250 0.18
251 0.15
252 0.13
253 0.12
254 0.11
255 0.08
256 0.08
257 0.09
258 0.12
259 0.12
260 0.11
261 0.12
262 0.12
263 0.12
264 0.13
265 0.1
266 0.08
267 0.09
268 0.11
269 0.18
270 0.2
271 0.25
272 0.29
273 0.32
274 0.32
275 0.35
276 0.39
277 0.34
278 0.35
279 0.34
280 0.31
281 0.28
282 0.28
283 0.25
284 0.18
285 0.2
286 0.19
287 0.16
288 0.17
289 0.2
290 0.21
291 0.26
292 0.34
293 0.41
294 0.46
295 0.49
296 0.54
297 0.61
298 0.67
299 0.64
300 0.61
301 0.61
302 0.61