Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9V7B4

Protein Details
Accession A0A0C9V7B4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
19-47DEYRDDSAKKAKKVKKKVAKKTVVNVKVAHydrophilic
NLS Segment(s)
PositionSequence
27-39KKAKKVKKKVAKK
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MAQDNGSRDVDSVVEGDDDEYRDDSAKKAKKVKKKVAKKTVVNVKVAKVDVRMAEDKDQAHGESEYEDEEEDANVQVDDKSNEKVEDEEQLGDKHEQERVDGHEQDIEHEQTDEVAQGNEHEQDEEHADDHHGSKTRRTLKTPGIMKYNDHGKHLFDTELQQHLDGMILLVLWMGILILPPSFHYLRKLDQLPKTLPLTAGDSSSQSDASTGVQPHNIVLPGDKSVCRTTLDDTSALEQQHISDKKFNSYSGADLQESNGSLHNSTLQDSVSTMDPTAVASFEECRTNSHVAPMMAVRGRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.11
5 0.11
6 0.12
7 0.12
8 0.12
9 0.14
10 0.14
11 0.17
12 0.25
13 0.31
14 0.38
15 0.47
16 0.55
17 0.64
18 0.74
19 0.82
20 0.83
21 0.87
22 0.9
23 0.91
24 0.93
25 0.9
26 0.89
27 0.88
28 0.83
29 0.79
30 0.71
31 0.63
32 0.57
33 0.51
34 0.42
35 0.33
36 0.3
37 0.25
38 0.28
39 0.28
40 0.25
41 0.28
42 0.3
43 0.29
44 0.28
45 0.28
46 0.22
47 0.21
48 0.19
49 0.15
50 0.13
51 0.13
52 0.11
53 0.1
54 0.1
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.06
62 0.07
63 0.07
64 0.08
65 0.1
66 0.11
67 0.12
68 0.14
69 0.14
70 0.14
71 0.15
72 0.15
73 0.17
74 0.16
75 0.16
76 0.15
77 0.15
78 0.17
79 0.16
80 0.17
81 0.15
82 0.16
83 0.15
84 0.14
85 0.16
86 0.2
87 0.24
88 0.23
89 0.22
90 0.22
91 0.22
92 0.23
93 0.24
94 0.19
95 0.14
96 0.13
97 0.13
98 0.1
99 0.1
100 0.09
101 0.06
102 0.06
103 0.05
104 0.05
105 0.07
106 0.08
107 0.08
108 0.07
109 0.07
110 0.08
111 0.1
112 0.1
113 0.09
114 0.08
115 0.08
116 0.09
117 0.1
118 0.12
119 0.15
120 0.15
121 0.18
122 0.25
123 0.34
124 0.36
125 0.39
126 0.42
127 0.43
128 0.51
129 0.53
130 0.49
131 0.45
132 0.42
133 0.39
134 0.37
135 0.4
136 0.33
137 0.3
138 0.27
139 0.23
140 0.23
141 0.23
142 0.21
143 0.12
144 0.14
145 0.14
146 0.16
147 0.15
148 0.14
149 0.12
150 0.12
151 0.11
152 0.09
153 0.06
154 0.03
155 0.03
156 0.03
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.03
167 0.04
168 0.08
169 0.09
170 0.1
171 0.13
172 0.16
173 0.18
174 0.24
175 0.29
176 0.32
177 0.36
178 0.4
179 0.39
180 0.4
181 0.4
182 0.35
183 0.3
184 0.24
185 0.23
186 0.18
187 0.18
188 0.14
189 0.14
190 0.14
191 0.14
192 0.13
193 0.09
194 0.08
195 0.08
196 0.09
197 0.12
198 0.12
199 0.12
200 0.14
201 0.14
202 0.14
203 0.15
204 0.14
205 0.1
206 0.11
207 0.11
208 0.12
209 0.14
210 0.14
211 0.16
212 0.17
213 0.18
214 0.19
215 0.19
216 0.21
217 0.24
218 0.26
219 0.23
220 0.23
221 0.24
222 0.25
223 0.24
224 0.2
225 0.15
226 0.14
227 0.22
228 0.24
229 0.24
230 0.27
231 0.29
232 0.35
233 0.37
234 0.36
235 0.32
236 0.3
237 0.31
238 0.3
239 0.32
240 0.26
241 0.25
242 0.26
243 0.23
244 0.22
245 0.19
246 0.17
247 0.15
248 0.14
249 0.14
250 0.17
251 0.16
252 0.17
253 0.17
254 0.15
255 0.14
256 0.14
257 0.16
258 0.14
259 0.14
260 0.12
261 0.11
262 0.11
263 0.12
264 0.12
265 0.1
266 0.08
267 0.08
268 0.11
269 0.13
270 0.17
271 0.17
272 0.19
273 0.24
274 0.28
275 0.28
276 0.31
277 0.34
278 0.29
279 0.31
280 0.29
281 0.31