Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9E1R0

Protein Details
Accession E9E1R0   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
21-45RGLFSRRPRHVHHQKRKPTMKDKVSBasic
NLS Segment(s)
PositionSequence
18-70APRRGLFSRRPRHVHHQKRKPTMKDKVSGAFMKLRGSLTRRPGLKAAGARRMH
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
KEGG maw:MAC_03878  -  
Amino Acid Sequences MPFGRRTHHHTTTTTARAPRRGLFSRRPRHVHHQKRKPTMKDKVSGAFMKLRGSLTRRPGLKAAGARRMHGTDGRGGHKHGYVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.49
4 0.49
5 0.51
6 0.48
7 0.47
8 0.49
9 0.5
10 0.54
11 0.61
12 0.65
13 0.7
14 0.71
15 0.7
16 0.74
17 0.78
18 0.79
19 0.79
20 0.8
21 0.81
22 0.86
23 0.89
24 0.86
25 0.84
26 0.82
27 0.77
28 0.71
29 0.64
30 0.57
31 0.52
32 0.45
33 0.37
34 0.31
35 0.26
36 0.22
37 0.21
38 0.19
39 0.18
40 0.21
41 0.25
42 0.28
43 0.33
44 0.34
45 0.35
46 0.36
47 0.35
48 0.36
49 0.38
50 0.37
51 0.4
52 0.4
53 0.39
54 0.41
55 0.4
56 0.38
57 0.34
58 0.3
59 0.27
60 0.31
61 0.35
62 0.34
63 0.34
64 0.34