Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9W0K8

Protein Details
Accession A0A0C9W0K8    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-40IPVHPPAKIRARFRNRKGDTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, extr 5, nucl 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027806  HARBI1_dom  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF13359  DDE_Tnp_4  
Amino Acid Sequences QSKKFYPFLKAAISATDGSHIPVHPPAKIRARFRNRKGDTSTNVLASCSFDMLYCHILAGWEGSISDGALLADARAHDFKPPQGRFFLGDAGFPLCNDMLVPYRGVRYHLREWESAKKRPATPKELFNLRHSQCRNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.2
4 0.16
5 0.15
6 0.16
7 0.14
8 0.14
9 0.19
10 0.2
11 0.2
12 0.24
13 0.29
14 0.36
15 0.43
16 0.49
17 0.54
18 0.64
19 0.71
20 0.76
21 0.8
22 0.75
23 0.76
24 0.75
25 0.72
26 0.65
27 0.62
28 0.56
29 0.47
30 0.42
31 0.35
32 0.28
33 0.21
34 0.18
35 0.11
36 0.09
37 0.07
38 0.07
39 0.09
40 0.1
41 0.08
42 0.08
43 0.07
44 0.07
45 0.07
46 0.07
47 0.05
48 0.04
49 0.03
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.02
59 0.03
60 0.03
61 0.05
62 0.06
63 0.06
64 0.08
65 0.09
66 0.13
67 0.23
68 0.24
69 0.25
70 0.26
71 0.27
72 0.27
73 0.28
74 0.28
75 0.19
76 0.17
77 0.16
78 0.17
79 0.15
80 0.13
81 0.12
82 0.08
83 0.07
84 0.07
85 0.08
86 0.09
87 0.1
88 0.11
89 0.11
90 0.13
91 0.14
92 0.18
93 0.22
94 0.25
95 0.32
96 0.38
97 0.41
98 0.42
99 0.47
100 0.54
101 0.56
102 0.56
103 0.56
104 0.55
105 0.58
106 0.65
107 0.69
108 0.67
109 0.65
110 0.66
111 0.68
112 0.7
113 0.67
114 0.63
115 0.65
116 0.59
117 0.63