Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VZT1

Protein Details
Accession A0A0C9VZT1   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-22TPSPRTPSQAQKRKGPPEFRHHydrophilic
25-54AERAKKLKKEWIEKKKIKGKWKAQTRKEGVBasic
NLS Segment(s)
PositionSequence
12-50QKRKGPPEFRHLPAERAKKLKKEWIEKKKIKGKWKAQTR
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MTPSPRTPSQAQKRKGPPEFRHLPAERAKKLKKEWIEKKKIKGKWKAQTRKEGVQDASLSFPVEENVNPTTRNASPQQSDGEDESSSATPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.81
4 0.76
5 0.76
6 0.77
7 0.71
8 0.71
9 0.62
10 0.59
11 0.57
12 0.6
13 0.55
14 0.57
15 0.58
16 0.55
17 0.58
18 0.6
19 0.6
20 0.62
21 0.68
22 0.7
23 0.76
24 0.75
25 0.8
26 0.81
27 0.79
28 0.77
29 0.76
30 0.75
31 0.73
32 0.79
33 0.79
34 0.77
35 0.8
36 0.76
37 0.73
38 0.67
39 0.62
40 0.52
41 0.45
42 0.4
43 0.3
44 0.26
45 0.2
46 0.16
47 0.12
48 0.11
49 0.09
50 0.09
51 0.08
52 0.09
53 0.11
54 0.12
55 0.12
56 0.13
57 0.17
58 0.17
59 0.22
60 0.23
61 0.27
62 0.29
63 0.31
64 0.34
65 0.31
66 0.34
67 0.31
68 0.29
69 0.23
70 0.21
71 0.21