Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9V665

Protein Details
Accession A0A0C9V665    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-54AAPIKCTKRQCAKTFRVRLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.666, nucl 12.5, mito 12.5, cyto_nucl 7.833, cyto_mito 7.833
Family & Domain DBs
Amino Acid Sequences MEARMPSSLPFPSHPRRPSFSLSLLDSTSPYAHAAAPIKCTKRQCAKTFRVRLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.53
4 0.55
5 0.56
6 0.53
7 0.49
8 0.43
9 0.39
10 0.35
11 0.3
12 0.25
13 0.2
14 0.17
15 0.13
16 0.1
17 0.08
18 0.07
19 0.07
20 0.1
21 0.13
22 0.13
23 0.18
24 0.24
25 0.27
26 0.32
27 0.35
28 0.41
29 0.48
30 0.57
31 0.61
32 0.65
33 0.72
34 0.78