Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UWW0

Protein Details
Accession A0A0C9UWW0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
5-34FQFRLPATKSQPKRQTRRLKQKTIRSSPASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MLPSFQFRLPATKSQPKRQTRRLKQKTIRSSPASPDVLYCTSAGDVITMEDNARSELLHPPPKKRRLQGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.7
3 0.73
4 0.79
5 0.81
6 0.84
7 0.85
8 0.9
9 0.89
10 0.9
11 0.89
12 0.9
13 0.9
14 0.87
15 0.83
16 0.77
17 0.7
18 0.62
19 0.6
20 0.5
21 0.4
22 0.32
23 0.27
24 0.22
25 0.21
26 0.17
27 0.11
28 0.09
29 0.1
30 0.09
31 0.06
32 0.05
33 0.05
34 0.06
35 0.05
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.06
42 0.07
43 0.14
44 0.22
45 0.31
46 0.34
47 0.44
48 0.54
49 0.64
50 0.71