Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UE23

Protein Details
Accession A0A0C9UE23   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-65YPPLCSPKQRRAQPRTRSRSRTRTRIHydrophilic
NLS Segment(s)
PositionSequence
49-62RRAQPRTRSRSRTR
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MSVNLRKLKVEAQGQNRKPKVNISRMRTSHHIPLHLNLLYPPLCSPKQRRAQPRTRSRSRTRTRIPPIHTLTLPTRKRIRTRHWIQTLPLPARAQTTRTMRIEGLRIGVGVGIAVEGAASGGGGEVGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.73
3 0.72
4 0.68
5 0.61
6 0.62
7 0.61
8 0.61
9 0.63
10 0.6
11 0.67
12 0.65
13 0.69
14 0.65
15 0.6
16 0.57
17 0.52
18 0.49
19 0.4
20 0.39
21 0.39
22 0.34
23 0.3
24 0.22
25 0.22
26 0.18
27 0.17
28 0.16
29 0.15
30 0.17
31 0.22
32 0.27
33 0.33
34 0.42
35 0.5
36 0.59
37 0.64
38 0.72
39 0.78
40 0.83
41 0.83
42 0.83
43 0.83
44 0.82
45 0.83
46 0.8
47 0.8
48 0.75
49 0.76
50 0.75
51 0.74
52 0.7
53 0.68
54 0.65
55 0.58
56 0.51
57 0.44
58 0.41
59 0.43
60 0.4
61 0.37
62 0.39
63 0.41
64 0.49
65 0.54
66 0.57
67 0.58
68 0.65
69 0.7
70 0.71
71 0.69
72 0.63
73 0.61
74 0.61
75 0.52
76 0.48
77 0.38
78 0.31
79 0.32
80 0.32
81 0.27
82 0.26
83 0.3
84 0.34
85 0.35
86 0.37
87 0.33
88 0.35
89 0.37
90 0.31
91 0.27
92 0.2
93 0.18
94 0.15
95 0.14
96 0.11
97 0.07
98 0.06
99 0.03
100 0.03
101 0.03
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02