Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9V8H8

Protein Details
Accession A0A0C9V8H8    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-40EATPLPSKKRRGALKRKTKVRDLPKATHydrophilic
NLS Segment(s)
PositionSequence
19-89PSKKRRGALKRKTKVRDLPKATSPPSKKWQGALKRKAKFPLQRSHPPSSQKKRGALKTKAPGNPDIRITKR
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 7, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MERKPKGRAIFWDEATPLPSKKRRGALKRKTKVRDLPKATSPPSKKWQGALKRKAKFPLQRSHPPSSQKKRGALKTKAPGNPDIRITKRVRVAKEADVNKDAEPSQGHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.34
4 0.27
5 0.28
6 0.32
7 0.35
8 0.4
9 0.47
10 0.55
11 0.64
12 0.73
13 0.76
14 0.81
15 0.84
16 0.88
17 0.85
18 0.84
19 0.82
20 0.81
21 0.81
22 0.76
23 0.72
24 0.69
25 0.69
26 0.64
27 0.63
28 0.57
29 0.53
30 0.53
31 0.54
32 0.48
33 0.46
34 0.52
35 0.53
36 0.59
37 0.63
38 0.65
39 0.63
40 0.65
41 0.65
42 0.64
43 0.61
44 0.57
45 0.57
46 0.55
47 0.61
48 0.64
49 0.66
50 0.63
51 0.64
52 0.68
53 0.68
54 0.7
55 0.66
56 0.67
57 0.69
58 0.74
59 0.75
60 0.72
61 0.71
62 0.7
63 0.72
64 0.68
65 0.63
66 0.61
67 0.55
68 0.52
69 0.48
70 0.47
71 0.42
72 0.46
73 0.47
74 0.46
75 0.5
76 0.54
77 0.52
78 0.51
79 0.52
80 0.53
81 0.59
82 0.58
83 0.55
84 0.51
85 0.49
86 0.43
87 0.41
88 0.33
89 0.27