Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ULV9

Protein Details
Accession A0A0C9ULV9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
42-63RHADDDKKSKRQKERRAALKLIBasic
NLS Segment(s)
PositionSequence
48-57KKSKRQKERR
Subcellular Location(s) mito 8, nucl 7, pero 5, cyto 4, cysk 3
Family & Domain DBs
Amino Acid Sequences TLHLIHPRPVEWSTIMGQIANILQVSLVPYVEWFARLDHASRHADDDKKSKRQKERRAALKLIEFYKLGLKNDARNAESMGLMPNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.18
4 0.17
5 0.15
6 0.13
7 0.11
8 0.09
9 0.05
10 0.05
11 0.05
12 0.07
13 0.06
14 0.06
15 0.05
16 0.05
17 0.06
18 0.06
19 0.07
20 0.06
21 0.06
22 0.09
23 0.09
24 0.1
25 0.1
26 0.15
27 0.16
28 0.16
29 0.19
30 0.21
31 0.23
32 0.25
33 0.33
34 0.35
35 0.43
36 0.49
37 0.53
38 0.61
39 0.68
40 0.77
41 0.78
42 0.81
43 0.81
44 0.83
45 0.78
46 0.72
47 0.67
48 0.61
49 0.52
50 0.44
51 0.34
52 0.27
53 0.31
54 0.3
55 0.26
56 0.27
57 0.29
58 0.32
59 0.4
60 0.44
61 0.38
62 0.36
63 0.36
64 0.31
65 0.29
66 0.24