Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9E2E7

Protein Details
Accession E9E2E7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
17-43RKDASSARIKKNKKSNNVKFKVRCQTHHydrophilic
NLS Segment(s)
PositionSequence
24-30RIKKNKK
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG maw:MAC_04045  -  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVADIKKFIEICRRKDASSARIKKNKKSNNVKFKVRCQTHLYTLVLKDTDKAEKLKQSLPPSTHRNAPFSNRVSPRELVGAILYPSSELATAKIDPRRFLLMCFFADLSIAEVGKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.51
4 0.46
5 0.52
6 0.57
7 0.55
8 0.59
9 0.63
10 0.63
11 0.69
12 0.74
13 0.75
14 0.79
15 0.79
16 0.78
17 0.8
18 0.81
19 0.83
20 0.86
21 0.87
22 0.82
23 0.82
24 0.82
25 0.74
26 0.68
27 0.63
28 0.59
29 0.54
30 0.54
31 0.46
32 0.38
33 0.36
34 0.32
35 0.26
36 0.22
37 0.18
38 0.14
39 0.15
40 0.14
41 0.16
42 0.16
43 0.2
44 0.22
45 0.25
46 0.28
47 0.31
48 0.33
49 0.34
50 0.38
51 0.39
52 0.39
53 0.42
54 0.38
55 0.38
56 0.36
57 0.38
58 0.4
59 0.37
60 0.43
61 0.41
62 0.42
63 0.42
64 0.4
65 0.36
66 0.31
67 0.27
68 0.2
69 0.16
70 0.14
71 0.1
72 0.1
73 0.08
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.09
81 0.1
82 0.15
83 0.21
84 0.23
85 0.24
86 0.27
87 0.33
88 0.3
89 0.31
90 0.33
91 0.3
92 0.29
93 0.31
94 0.27
95 0.21
96 0.21
97 0.19
98 0.15
99 0.13
100 0.12