Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9V3P6

Protein Details
Accession A0A0C9V3P6    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPSQRRRKKFRLKLRGVRIRRYALBasic
NLS Segment(s)
PositionSequence
5-20RRRKKFRLKLRGVRIR
Subcellular Location(s) mito 17.5, cyto_mito 10.166, nucl 7, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MPSQRRRKKFRLKLRGVRIRRYALCFLFGYTAYLPLDSRTLTPRLRFKLPVSPTLDLEYSGSHRNYEFSREFHGKHTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.93
3 0.88
4 0.86
5 0.81
6 0.77
7 0.71
8 0.66
9 0.6
10 0.5
11 0.47
12 0.39
13 0.33
14 0.27
15 0.23
16 0.19
17 0.13
18 0.14
19 0.11
20 0.11
21 0.1
22 0.09
23 0.1
24 0.08
25 0.09
26 0.1
27 0.13
28 0.15
29 0.19
30 0.25
31 0.29
32 0.32
33 0.34
34 0.34
35 0.39
36 0.4
37 0.43
38 0.42
39 0.39
40 0.37
41 0.37
42 0.35
43 0.26
44 0.24
45 0.18
46 0.15
47 0.19
48 0.18
49 0.16
50 0.16
51 0.19
52 0.2
53 0.26
54 0.27
55 0.24
56 0.32
57 0.36
58 0.37