Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9UI36

Protein Details
Accession A0A0C9UI36    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
91-114DRASAKARRTRGRRPGGSNNSNTSHydrophilic
NLS Segment(s)
PositionSequence
95-105AKARRTRGRRP
Subcellular Location(s) nucl 16, cyto 7, mito 4
Family & Domain DBs
Amino Acid Sequences LPMIRSLPSDYSSFVSAITLMDSIDMSKLKTAFITEESNRKEAMEGQFGATAAANLATMSRTSNVIICGWCERPGHVEDQCFSKKASMQQDRASAKARRTRGRRPGGSNNSNTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.12
4 0.11
5 0.1
6 0.08
7 0.06
8 0.06
9 0.06
10 0.06
11 0.08
12 0.08
13 0.07
14 0.1
15 0.1
16 0.1
17 0.1
18 0.11
19 0.11
20 0.14
21 0.19
22 0.19
23 0.26
24 0.29
25 0.3
26 0.29
27 0.27
28 0.25
29 0.23
30 0.24
31 0.2
32 0.18
33 0.18
34 0.18
35 0.18
36 0.18
37 0.13
38 0.1
39 0.05
40 0.05
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.05
48 0.05
49 0.06
50 0.07
51 0.08
52 0.09
53 0.09
54 0.1
55 0.12
56 0.12
57 0.15
58 0.14
59 0.14
60 0.16
61 0.18
62 0.21
63 0.2
64 0.21
65 0.19
66 0.26
67 0.27
68 0.25
69 0.24
70 0.22
71 0.23
72 0.28
73 0.38
74 0.4
75 0.43
76 0.47
77 0.55
78 0.55
79 0.55
80 0.54
81 0.48
82 0.47
83 0.5
84 0.53
85 0.55
86 0.6
87 0.68
88 0.72
89 0.79
90 0.79
91 0.8
92 0.83
93 0.84
94 0.85