Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VIV7

Protein Details
Accession A0A0C9VIV7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
74-96GTPQRTYKRKWSRWESAQRHKEGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, extr 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010530  B12D  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF06522  B12D  
Amino Acid Sequences MSGPLRNFRRNWFRLRYMAVGGICSFAVYFLGMKAGTSPDVVWSRANPQPWNTIHPNETIKAGMMLGPRIDPAGTPQRTYKRKWSRWESAQRHKEGNIISYKTKLEAADSENRAGSEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.59
4 0.51
5 0.49
6 0.41
7 0.34
8 0.28
9 0.23
10 0.17
11 0.14
12 0.11
13 0.07
14 0.06
15 0.05
16 0.05
17 0.04
18 0.06
19 0.06
20 0.06
21 0.07
22 0.07
23 0.07
24 0.08
25 0.08
26 0.11
27 0.13
28 0.14
29 0.14
30 0.14
31 0.18
32 0.2
33 0.23
34 0.2
35 0.2
36 0.26
37 0.27
38 0.32
39 0.31
40 0.31
41 0.29
42 0.3
43 0.3
44 0.24
45 0.23
46 0.17
47 0.14
48 0.11
49 0.1
50 0.09
51 0.08
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.05
59 0.09
60 0.18
61 0.19
62 0.2
63 0.26
64 0.35
65 0.39
66 0.44
67 0.51
68 0.52
69 0.59
70 0.68
71 0.71
72 0.72
73 0.78
74 0.85
75 0.84
76 0.84
77 0.84
78 0.79
79 0.73
80 0.64
81 0.58
82 0.48
83 0.45
84 0.41
85 0.36
86 0.34
87 0.34
88 0.34
89 0.31
90 0.32
91 0.26
92 0.21
93 0.22
94 0.25
95 0.32
96 0.34
97 0.34
98 0.33