Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9UH25

Protein Details
Accession A0A0C9UH25    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSRCRTVTPSHRRRRRCIPAATQAVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 7, mito_nucl 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSRCRTVTPSHRRRRRCIPAATQAVSSVDNLRLKSLCLLHEDCPGEELLKSRRIRFLNLGPFDLLLFPFMFPVLLSVTARNSGQGEACWSSSDAMMVEDNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.84
4 0.82
5 0.8
6 0.81
7 0.81
8 0.74
9 0.64
10 0.53
11 0.45
12 0.36
13 0.28
14 0.2
15 0.17
16 0.18
17 0.17
18 0.18
19 0.17
20 0.17
21 0.19
22 0.19
23 0.15
24 0.18
25 0.2
26 0.2
27 0.25
28 0.25
29 0.22
30 0.21
31 0.2
32 0.16
33 0.13
34 0.14
35 0.12
36 0.18
37 0.2
38 0.2
39 0.26
40 0.27
41 0.3
42 0.32
43 0.36
44 0.38
45 0.38
46 0.38
47 0.32
48 0.31
49 0.28
50 0.24
51 0.16
52 0.08
53 0.07
54 0.06
55 0.06
56 0.06
57 0.05
58 0.05
59 0.06
60 0.06
61 0.07
62 0.08
63 0.09
64 0.1
65 0.12
66 0.12
67 0.13
68 0.13
69 0.12
70 0.13
71 0.12
72 0.16
73 0.16
74 0.17
75 0.17
76 0.17
77 0.16
78 0.16
79 0.16
80 0.11
81 0.11