Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VLT3

Protein Details
Accession A0A0C9VLT3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-84SKSTTSTQSHPKRERKKKRNTPFNPGFLHydrophilic
NLS Segment(s)
PositionSequence
67-75PKRERKKKR
Subcellular Location(s) mito 11, extr 7, plas 3, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQQQRHSHNTPAPAQAYALTRTGVIVHLLMAAAALAAASLAVSSAVYCCVCVVFANSKSTTSTQSHPKRERKKKRNTPFNPGFLTTAPPSPEFGTVCHLGSLDLRRGLEEIERKKDMNVSGVGAIFGRLDFEVIGVVDIDIVEASCVLLWRGLRTFLKRLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.32
4 0.27
5 0.24
6 0.18
7 0.16
8 0.15
9 0.16
10 0.13
11 0.11
12 0.08
13 0.07
14 0.07
15 0.07
16 0.06
17 0.05
18 0.04
19 0.03
20 0.03
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.03
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.09
40 0.13
41 0.15
42 0.19
43 0.19
44 0.2
45 0.22
46 0.23
47 0.24
48 0.21
49 0.23
50 0.3
51 0.38
52 0.47
53 0.54
54 0.63
55 0.69
56 0.78
57 0.86
58 0.86
59 0.89
60 0.9
61 0.92
62 0.94
63 0.88
64 0.87
65 0.83
66 0.78
67 0.69
68 0.59
69 0.49
70 0.38
71 0.35
72 0.26
73 0.2
74 0.16
75 0.14
76 0.14
77 0.14
78 0.15
79 0.13
80 0.13
81 0.14
82 0.14
83 0.14
84 0.13
85 0.12
86 0.1
87 0.12
88 0.14
89 0.13
90 0.14
91 0.13
92 0.13
93 0.14
94 0.14
95 0.16
96 0.22
97 0.25
98 0.29
99 0.31
100 0.31
101 0.32
102 0.35
103 0.31
104 0.28
105 0.23
106 0.19
107 0.18
108 0.18
109 0.17
110 0.13
111 0.12
112 0.08
113 0.07
114 0.07
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.05
121 0.06
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.05
135 0.07
136 0.08
137 0.12
138 0.14
139 0.2
140 0.25
141 0.3
142 0.36