Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9U937

Protein Details
Accession A0A0C9U937    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-32RRTPWAGYAQRHRRLRRHKIDKTVQIRTRBasic
NLS Segment(s)
PositionSequence
16-21RRLRRH
Subcellular Location(s) nucl 14, cyto_nucl 11, mito 7, cyto 6
Family & Domain DBs
Amino Acid Sequences TRLRRTPWAGYAQRHRRLRRHKIDKTVQIRTRHRDISSTPPQGFGYPVAQRATSFDHARTYSFDRDVEAASAPSYSRLVSQCHFHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.77
4 0.81
5 0.84
6 0.85
7 0.86
8 0.84
9 0.86
10 0.88
11 0.88
12 0.85
13 0.84
14 0.79
15 0.77
16 0.76
17 0.71
18 0.68
19 0.62
20 0.55
21 0.48
22 0.45
23 0.45
24 0.46
25 0.46
26 0.4
27 0.37
28 0.37
29 0.34
30 0.31
31 0.23
32 0.18
33 0.13
34 0.16
35 0.15
36 0.15
37 0.14
38 0.16
39 0.19
40 0.2
41 0.2
42 0.19
43 0.22
44 0.22
45 0.23
46 0.25
47 0.25
48 0.25
49 0.25
50 0.24
51 0.22
52 0.22
53 0.22
54 0.2
55 0.16
56 0.13
57 0.11
58 0.11
59 0.1
60 0.1
61 0.1
62 0.09
63 0.12
64 0.14
65 0.19
66 0.21