Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9W286

Protein Details
Accession A0A0C9W286    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-35TGERRFRRGYSKHNPRKMVRBasic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 12.5, nucl 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000687  RIO_kinase  
IPR018935  RIO_kinase_CS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0046872  F:metal ion binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF01163  RIO1  
PROSITE View protein in PROSITE  
PS01245  RIO1  
Amino Acid Sequences FKTSILVFKDRDKYVTGERRFRRGYSKHNPRKMVRLWAEKEMRNLKRLVGAGIPCPEPIEVRENVLVMAFLGDSAGWASPRLKDADLPEDRLAILYKGLLFTVRKMFHECKLVHADLSEYNILYHEEQLYIIDVGQSVEQDHPSAFDFLRADLKNVEEFFGRRGVSCVGVRNAFEFVIGELSEGQDAESWLERLLTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.52
4 0.54
5 0.57
6 0.64
7 0.65
8 0.63
9 0.63
10 0.6
11 0.63
12 0.64
13 0.71
14 0.73
15 0.79
16 0.84
17 0.78
18 0.8
19 0.75
20 0.74
21 0.71
22 0.71
23 0.65
24 0.66
25 0.68
26 0.62
27 0.64
28 0.64
29 0.58
30 0.51
31 0.48
32 0.4
33 0.39
34 0.37
35 0.3
36 0.25
37 0.23
38 0.23
39 0.25
40 0.25
41 0.19
42 0.19
43 0.18
44 0.14
45 0.15
46 0.16
47 0.13
48 0.15
49 0.16
50 0.15
51 0.15
52 0.14
53 0.12
54 0.07
55 0.07
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.03
64 0.05
65 0.06
66 0.07
67 0.08
68 0.1
69 0.1
70 0.12
71 0.14
72 0.22
73 0.23
74 0.26
75 0.24
76 0.23
77 0.23
78 0.21
79 0.19
80 0.1
81 0.09
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.08
89 0.14
90 0.14
91 0.15
92 0.21
93 0.23
94 0.24
95 0.31
96 0.3
97 0.28
98 0.32
99 0.32
100 0.26
101 0.24
102 0.23
103 0.16
104 0.18
105 0.14
106 0.09
107 0.09
108 0.09
109 0.1
110 0.09
111 0.1
112 0.08
113 0.07
114 0.07
115 0.08
116 0.08
117 0.07
118 0.07
119 0.06
120 0.05
121 0.06
122 0.06
123 0.06
124 0.06
125 0.07
126 0.07
127 0.08
128 0.07
129 0.08
130 0.09
131 0.11
132 0.1
133 0.12
134 0.12
135 0.13
136 0.21
137 0.2
138 0.2
139 0.19
140 0.21
141 0.22
142 0.22
143 0.22
144 0.16
145 0.16
146 0.17
147 0.2
148 0.18
149 0.15
150 0.17
151 0.17
152 0.2
153 0.21
154 0.25
155 0.25
156 0.27
157 0.27
158 0.26
159 0.26
160 0.22
161 0.2
162 0.15
163 0.11
164 0.11
165 0.1
166 0.1
167 0.08
168 0.09
169 0.09
170 0.09
171 0.08
172 0.07
173 0.08
174 0.1
175 0.11
176 0.11
177 0.11